KEGG   Electrophorus electricus (electric eel): 113576086
Entry
113576086         CDS       T05787                                 

Gene name
tm7sf2
Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee00100  Steroid biosynthesis
eee01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eee00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    113576086 (tm7sf2)
Enzymes [BR:eee01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     113576086 (tm7sf2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 113576086
NCBI-ProteinID: XP_026863809
Position
Unknown
AA seq 420 aa
MKPGRHERRSAEMEFGGTLGATCIPVFLPLTVLYLLSVCQSPGAIVVQWPPPLPPSTHLW
HPWVPAIIGGWIALQVFLYLLPVGKISQGLVLRDGSRLKYPINGFQALCVTGLLLGLCLW
LGMPLGNLFDLMLPLAVCATAVAYLLSLYLYMRSFWAPPHALALGGNTGNPLYDFFMGRE
LNPRIGSFDLKYFCELRPGLIGWVVLNLAMLMKEVELRGSPSLPLLLVNSFQLLYVTDAL
WNEEAVLTTMDIVHDGFGFMLAFGDLAWVPFTYSLQAVFLVGHPHTLSPLAALGIIILNG
VGYYIFRKSNSQKNQFRRDPTHTSVAHLETIATATGKRLLVSGWWGFVRHPNYLGDILMA
LAWSLPCGISHIVPYFYVIYFTILLIHREDRDERQCRAKYGVAWDTYCRRVPYRIIPYLY
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgaaacccggcagacacgagaggcgttccgctgaaatggaatttggaggaactttgggc
gccacatgcattcctgtctttctgcccctgactgttttgtacttgctgagtgtgtgtcag
tccccaggcgccattgtagtccagtggcctccccctctcccgccctccactcacctctgg
cacccgtgggtccctgccatcatcggtggctggattgccctccaggttttcctctacttg
cttccagtgggcaagatttcccaggggttagttcttagggatgggtccagactaaaatat
ccaatcaatggcttccaggctctgtgtgtcactggcctcctgctgggcctgtgtctgtgg
ttggggatgccccttggaaacctgtttgatttgatgttgcctcttgcagtgtgtgccact
gcagtggcatacctgctatcactctacctgtacatgcgttcattctgggcccctccccat
gccctggcactcggaggaaacacaggtaatcccctgtatgatttctttatgggacgggaa
cttaaccctcgcattgggtcctttgaccttaaatacttctgtgagctgaggccagggtta
attggctgggtggtgctgaacctggccatgctgatgaaggaggtggagcttagaggatct
ccatctctgccattgctgctagtcaacagcttccagctgctctatgtcactgacgccctg
tggaatgaggaggctgttttgaccaccatggacattgtgcatgacgggttcgggtttatg
ctggcatttggggacctggcgtgggtgcctttcacatacagtctccaggctgtgtttctg
gttgggcatccacacacgctcagccctcttgctgcactgggaattatcattctgaatgga
gttggctattatatattccgtaagtctaattctcagaagaaccagtttaggagagaccct
acacacacaagtgttgcgcacttggaaactattgccactgcaacaggaaagcgtctgcta
gtgtcaggctggtggggtttcgtcagacacccaaactacctgggagacatcttgatggca
ctggcatggtctctgccttgcgggatttcacacattgtgccttatttttatgtaatttat
tttactattttactcattcatcgagaggaccgtgatgaacggcagtgcagagccaagtat
ggtgtggcgtgggacacttactgcagacgcgtgccctaccggatcattccctacctgtac
tga

DBGET integrated database retrieval system