KEGG   Electrophorus electricus (electric eel): 113576722Help
Entry
113576722         CDS       T05787                                 

Definition
(RefSeq) arylamine N-acetyltransferase, pineal gland isozyme NAT-10-like
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee00232  Caffeine metabolism
eee00983  Drug metabolism - other enzymes
eee01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eee00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    113576722
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    113576722
Enzymes [BR:eee01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     113576722
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-GeneID: 113576722
NCBI-ProteinID: XP_026864767
Position
Unknown
AA seq 239 aa AA seqDB search
MGYKYTTLSSKVFDTFNNDFDDMDSHFINMIEIDGKLYIADVGFGTWGQLWHPIEMIAGS
KPWQGTQQPVSRPRVLGDAQTVSGVLGEAQTVSGVLGDTQAASDVLQDTPSAAATPPDLM
LIDAVSLDPSPATAMHPDPGTMYSFTLTPRSHDYFLKKAEHLQTSPESLYTKKSICSLQL
ATGFRALIGWTYIEVKFNSEDDVDLTDIKDIPDGEVEIVLREKFNVTLLNKLTPKNKKI
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgggctacaaatacactacactgagctccaaggtcttcgatacatttaacaatgacttc
gacgacatggattcacatttcatcaacatgatcgagatcgatggcaagctgtacatcgct
gatgtgggttttggcacgtggggtcaactctggcacccgatagaaatgatcgcaggctcc
aagccctggcagggaacacaacagcccgtttccaggcctcgcgtgctcggggatgcacag
accgtgtccggcgtgctcggggaagcacagaccgtgtccggcgtactcggggacactcag
gccgcgtctgatgtgctgcaggacacaccatcagcagcagccacacccccagacctgatg
ctgattgatgctgtgtccctagacccatcacctgccacagctatgcatccggaccccggc
accatgtacagcttcactttaacgccacgcagccatgactattttctgaagaaagccgaa
cacctacagaccagtcctgagtctttgtacaccaaaaaatccatctgttccttacagctt
gccacaggcttcagagctttgattggttggacctacattgaggtcaaattcaactctgaa
gatgatgtggacctcactgatataaaggacataccagatggtgaggtagagattgtacta
agggaaaagtttaatgttactttgctaaataaattaacacctaaaaacaagaaaatatag

DBGET integrated database retrieval system