KEGG   Electrophorus electricus (electric eel): 113576839Help
Entry
113576839         CDS       T05787                                 

Definition
(RefSeq) band 3 anion exchange protein-like
  KO
K06573  solute carrier family 4 (anion exchanger), member 1
Organism
eee  Electrophorus electricus (electric eel)
Brite
KEGG Orthology (KO) [BR:eee00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eee02000]
    113576839
   04147 Exosome [BR:eee04147]
    113576839
   04090 CD molecules [BR:eee04090]
    113576839
Transporters [BR:eee02000]
 Solute carrier family (SLC)
  SLC4: Bicarbonate transporter
   113576839
Exosome [BR:eee04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   113576839
CD molecules [BR:eee04090]
 Proteins
  113576839
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HCO3_cotransp Band_3_cyto
Motif
Other DBs
NCBI-GeneID: 113576839
NCBI-ProteinID: XP_026864968
Position
Unknown
AA seq 836 aa AA seqDB search
MMDHNQQGHMQEMGQWAGYKENYDPEAGHWGLPRISYLTFKSLVQVYRTMETGVVLLDVE
ERSLSGIAEKIVDEMVTKKEIRPEDRDGLLQAVRQSGSQSAEAQALTSTLEMQTFSVAER
RDALESVEVSVLFVGALDSLERPAMALVQLREAAVLDALQALGPVRLLFLLVGPTKSEMD
YHDTGHAMAALLADKVFSQAVTHAQSDREVADAVASFMDCSVVIPPTEIQNEAMLAPIIG
FQKKLLQERLRPHDSQPHLDFKPRKLSSARERPEEDPLLRSGIPFGGVIRDVKRRYRHYV
SDITDALNAQVLAAVIFIYFAALSPAITFGGLLADKVDNMMGVSELMLSTAVQGVIFCLL
AAQPVLIIGFSGPLLVFEEAFYGFCRAQDVEYLVGRVWIGMWLMVIVVLTVALEGSFLVR
FISRFTQEIFSILISLIFIYETFTKLANTFKAHPLNLNYEHLNTTDPWQPVVVRHTFLDG
STGNVTTATSIRYRSYPNTALLSMCLMFGCFSIAYFLRIFKNGYFLPGKVRRLMGDFGVP
IAILLMVAVDISINDTYTQKLVVPQGLQVSNPAARGWLINPTGERKRFPVWMMIACVVPA
FLVFILIFLESQITTLIISKPERKMVKGSGFHLDLLILVILGGCSALFGMPWLSATTVRS
VTHANALTVMSKGPKPQIERVLEQRVSGVLVAILVGLSIFMEPILKMIPMPALFGIFLYM
GITSLSGIQLWDRILLLLVPKKYHPNEPYATRVMTSRMHMFTAIQVVCLAMLWTAKSSVL
SLALPFILILTVPLRMYMTGRVFTQLEMKCLDADDAKATFEEEPGVDMYSETRMPA
NT seq 2511 nt NT seq  +upstreamnt  +downstreamnt
atgatggaccataaccagcagggccacatgcaggagatgggccaatgggcaggctacaag
gagaactatgaccctgaggcgggccactggggattaccacgcatctcttacctgaccttc
aagagcctggtgcaggtctacaggaccatggaaaccggagtggtgctgttggacgtggag
gaacgctcactctctggcatcgctgagaagatcgtggacgagatggtcaccaagaaggag
atcaggcctgaagaccgggatgggcttctccaagccgtgagacagagtggcagccaatca
gcagaagcacaggctctgacctcaaccctggaaatgcaaacattctctgttgcagagagg
agagatgctcttgaaagtgtggaagtttctgtgctgtttgtaggtgcgctggactccctg
gagaggccagccatggccctggtccagctgagagaggctgcagtcctggacgctctgcag
gccctgggccctgtgcgcttgctcttcctcctggtgggccccaccaagagtgaaatggac
taccacgacaccggacatgctatggctgccctgctggctgataaagtgttcagtcaggcg
gtgacccatgctcagagtgacagggaggtggctgatgccgtggctagtttcatggactgc
agcgttgtgatcccgcccaccgagatccagaacgaagccatgctcgcaccaatcatcggc
ttccaaaagaagctcctgcaggagaggctccgcccccatgactctcagccccaccttgac
ttcaaaccccgcaaactgtccagtgcaagagagcgtccggaggaggacccgttgttgcgt
tcgggaattccgtttggaggcgtgatccgggacgtgaagaggcggtaccggcactacgtt
agtgacatcaccgacgccctcaacgctcaggttcttgctgctgtcatcttcatctacttc
gctgccctctcccctgcaatcacctttggaggcctgctagctgataaagtggacaacatg
atgggtgtgtcggagctgatgctgtctactgcagtacagggtgtcatcttctgtcttctc
gccgcccagccagtccttatcattggtttctctggaccactgctggtgttcgaggaagcc
ttctatgggttctgcagggctcaggacgtggagtacctcgtaggcagggtgtggatcggc
atgtggctcatggtcatcgtggtactgactgtggcgctcgagggcagcttcctggtccgc
ttcatctctcgcttcacccaggagatcttctccatcctcatctctctcatcttcatctac
gagaccttcaccaaacttgccaatacttttaaggctcatcctcttaatctcaactatgag
cacttgaacaccacggacccgtggcagccagtcgtcgtgcgccacacctttctggatggt
tccacaggcaacgtaaccacggcaaccagcatccgctaccgttcctaccccaacaccgcc
ctgctgtccatgtgcctgatgttcggctgtttctccatcgcatacttcctgcgcatattc
aaaaatggctactttttgcctggcaaggtccgacgtttgatgggcgactttggtgttccc
atcgctattttactcatggttgcagtggacatcagtatcaatgatacctacactcagaaa
ctggtggtccctcaggggttgcaggtgtctaaccccgccgcacggggctggctcatcaac
cccactggcgagcgcaaacgcttcccggtctggatgatgatcgcctgcgtcgtgcccgcc
ttcctcgtcttcatcctcatcttcctcgagtcgcagatcaccacgctgatcataagtaag
ccagagaggaagatggtgaagggatctgggttccatctggaccttctcattcttgtcatc
ctgggggggtgcagtgccctgttcggaatgccctggctcagtgctacaacggtacggtcc
gtaacccacgccaacgccttgaccgtcatgagtaaggggcccaagccgcagatagaaaga
gttctggaacaaagggtcagtggagtattggtggccatacttgtaggcctgtccatcttc
atggagcccatcctgaagatgattcccatgccggctctgttcggaatcttcctctacatg
ggaatcacatcgctgagtggcattcagctgtgggatcgcattctgctcctcctcgttccc
aaaaagtatcatcccaatgaaccgtacgctacaagagtgatgacgagcaggatgcacatg
ttcacggccatccaggtggtgtgcctggccatgctgtggacagcgaagtcaagcgttttg
tctcttgcgctgcccttcatcctcatcctcaccgtgcctctgcgcatgtacatgactggc
cgcgtcttcacacagcttgagatgaaatgcctggatgctgatgatgccaaagcaacattt
gaagaggagcctggtgtggacatgtactcagaaacgcgcatgccagcgtaa

DBGET integrated database retrieval system