KEGG   Electrophorus electricus (electric eel): 113577314Help
Entry
113577314         CDS       T05787                                 

Gene name
etnppl
Definition
(RefSeq) ethanolamine-phosphate phospho-lyase isoform X1
  KO
K14286  ethanolamine-phosphate phospho-lyase [EC:4.2.3.2]
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee00564  Glycerophospholipid metabolism
eee01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eee00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    113577314 (etnppl)
Enzymes [BR:eee01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.2  ethanolamine-phosphate phospho-lyase
     113577314 (etnppl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-GeneID: 113577314
NCBI-ProteinID: XP_026865694
Position
Unknown
AA seq 490 aa AA seqDB search
MATEVFDKQKTIDLRKKYIGPSCKVFFNHDPIKIIRARGQYMYSEKDEQYLDCINNVAHV
GHSHPEVVSAGTKQMELLNTNSRFLHDNLVHYAQRLQATLPEKLSVCYFVNSGSEANDLA
LRLAWQHTGHKDIITLDNAYHGHVSSLIDISPYKFHQLGQTEQSQHVHVAPSPDIYRGKF
REDHPDPATAYADEVRDIIEKAHAKGHKIAAFIAESLQSCGGQVIPPVGYFQKVAHHVRN
VGGVFIADEVQVGFGRVGSHFWAFQLQGDDFVPDIVTMGKPIGNGHPMSCVVTTREVAES
FMSSGMEYFNTFGGNPVSCAIGMAVLDVIEKEDLQGNALRVGKYLMELLEKLKEKHPLIG
DTRGCGLFVGVDLVKDRLKRTPATAEAQDVIYRLKDQKILLSADGPHRNVLKFKPPMCFS
REDADLAVGKIDHILTDLEKALGLCISDAPDLESVPNKRKNSFKEIVHGFQSNSVSNSNT
NTRTNKKQRT
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggcaactgaagtttttgataaacagaaaaccatcgatctgagaaagaaatatattggt
ccctcctgcaaagtcttcttcaaccatgaccccatcaaaattatacgagcccgaggtcag
tacatgtacagtgagaaagacgagcagtatctggactgcatcaacaacgttgcccatgtt
ggacacagtcatccagaggttgttagtgcagggaccaagcagatggagctcctgaacacc
aactcccgttttctgcatgacaaccttgtgcactatgcgcagcgcctccaagccactctg
cctgaaaagctctctgtctgctacttcgttaactcaggctctgaagccaatgacctggcc
ttgagattggcttggcagcacactggtcacaaagacatcatcacgctggataatgcctat
catggccacgtgtcctcgctcattgatatcagcccctataagtttcaccagctggggcag
acggagcagagccaacatgtgcacgtggctccaagtccagacatctacagaggaaaattc
agagaagaccacccagaccctgctaccgcctatgctgatgaagttagagacatcatcgag
aaagcgcatgcaaaagggcataagatcgctgcttttattgccgaatccctgcagagttgt
ggagggcaggttatccccccggtgggctacttccagaaagtggcacaccatgtgagaaac
gtggggggtgtcttcattgctgatgaagtgcaggttggttttggaagggtaggcagccat
ttctgggcttttcaactgcaaggggatgattttgtgcccgatattgtgacaatgggcaaa
cccattgggaatgggcacccaatgtcctgtgtcgtaactaccagagaggtggctgaaagc
ttcatgtcatctggaatggagtactttaacacatttggagggaatccagtgtcgtgtgct
atcggaatggccgtgcttgatgtaattgagaaggaggatctccaaggcaatgccctgcgt
gtgggaaaatacctgatggagttactggagaagctgaaggagaaacaccccttaatagga
gacaccagaggctgtgggctttttgttggagtggacctggtgaaagaccgacttaaaaga
acccctgcaacagctgaagcccaggacgtcatttacagactgaaggatcagaaaatttta
ttaagtgcagatgggccacaccgcaatgttctgaagttcaaaccccccatgtgcttctcc
agagaagatgctgatttggcagttggaaaaattgatcacattcttacagacctcgaaaag
gctttggggctctgtatatctgatgctccagatcttgaaagtgtacctaacaagagaaag
aactcttttaaggaaattgtgcatggattccagtcaaatagtgtcagtaacagcaataca
aacacaaggactaacaaaaaacaaagaacataa

DBGET integrated database retrieval system