KEGG   Electrophorus electricus (electric eel): 113577638Help
Entry
113577638         CDS       T05787                                 

Definition
(RefSeq) probable low-specificity L-threonine aldolase 2 isoform X1
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee00260  Glycine, serine and threonine metabolism
eee01100  Metabolic pathways
eee01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:eee00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    113577638
Enzymes [BR:eee01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     113577638
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 OKR_DC_1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-GeneID: 113577638
NCBI-ProteinID: XP_026866200
Position
Unknown
AA seq 419 aa AA seqDB search
MTVNTLSIAIRALSRCIKCRPTSRISRRCFGASPARFYYETTKTADSSAGSPALRTVDLR
SDTVTTPGPAMRRAMAEAEVGDDVFGEDPTVNELQKMAADIFGMEAALFVPTGTMSNLIA
VMVHCRERGDEMIVGDLSHLHMYEQGGSAQLAGVHSTTLTTLADGTFDLDQLESKICHGY
PDAHYPRSRLVCVENTHNILGGRVLPLSFLQELRSMADKYGLVVHMDGARLMNAAVALGL
QPSVILQHCHTVSACLSKGLGAPAGTMLAGSKDFIQRAVRARKALGGGMRQLGILAAAGK
IALKDMPARLGEDHRNARSFAKALTQCSPPLYQVDSATVETNIVLFRVRAPGLSPASFCE
LMGEVGKGEGEALGQGLRVLLFPHFGDTVRAMWHLGVSEEDTQLAAKKAQYVAQQYGLK
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgactgttaatacactgtctattgctattcgtgcactttcacgttgcataaaatgccgc
ccgacgtcgcgcattagtcgtcgctgttttggagcgagtcctgccagattctactatgaa
actacaaagacggcagacagcagcgcgggatcacctgctctgcgcaccgtggatctccgc
agtgatactgtcaccacgccaggaccggcgatgcgcagagctatggcagaggcagaggtt
ggggacgatgtgttcggtgaagaccccacagttaatgagctgcagaaaatggcagctgac
atctttggcatggaggcagctttgtttgtcccaacagggaccatgagcaatctgattgca
gtcatggtccactgcagggagagaggggatgaaatgatagtgggggatctctctcattta
cacatgtatgagcagggagggagtgcacagcttgctggtgtacactccactacactcact
actcttgctgacggaacgtttgatctggaccagctggagtcaaagatttgtcatggttac
cccgatgctcactacccccgttcccgcctggtgtgtgtggaaaacacacacaatattctg
ggtggacgtgtgctcccactctccttcctgcaggagctgcgctctatggcagataagtat
gggcttgttgtgcatatggatggtgccaggctgatgaatgcagcagtggctctgggcctt
cagccctctgtcatactccagcactgccacaccgtcagtgcctgtctgtctaagggactg
ggggcaccagctggcaccatgcttgctgggtccaaagacttcatccagagggcagtgcgt
gcacgtaaagcactgggcggtggaatgcgccagttaggcattttggcagcagctggtaag
attgccctgaaggacatgcctgccagactaggggaggaccacaggaatgccaggagcttt
gctaaagctctgacacagtgcagtccccctctgtaccaggtggactcggccaccgtggaa
accaacatagtactcttcagagtgcgagcccctgggctgagccctgcatcgttctgtgag
ctgatgggagaggtgggtaagggtgagggcgaggctctgggccaaggcttgcgtgtactc
ttgttccctcatttcggggacactgtgagagccatgtggcatctgggcgttagtgaggag
gacactcagctggctgcaaagaaagctcagtatgttgctcagcagtatggcttaaagtga

DBGET integrated database retrieval system