KEGG   Electrophorus electricus (electric eel): 113578195
Entry
113578195         CDS       T05787                                 

Gene name
adamts13
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
eee  Electrophorus electricus (electric eel)
Brite
KEGG Orthology (KO) [BR:eee00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:eee01002]
    113578195 (adamts13)
Enzymes [BR:eee01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     113578195 (adamts13)
Peptidases and inhibitors [BR:eee01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   113578195 (adamts13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin Reprolysin_3 TSP1_spondin Reprolysin_5 TSP1_CCN Reprolysin_4 ADAM_spacer1 Reprolysin_2 Peptidase_M10 Peptidase_M66
Other DBs
NCBI-GeneID: 113578195
NCBI-ProteinID: XP_026867111
Position
Unknown
AA seq 1452 aa
MAALLLLFLTSLMVDKALLTSQFSLEKQGLILFYSENRKLHIRPLLQIHSDHLRSSVDRP
PGLPHLVWYRPSPVGPRPRQSHSHHRLRRALTGAQLTHLELLVVVGPDVYEVHKQDTERY
ILTNLNIASELLRDVTLGANMRVHLVRMIILTEPEPEIHISDNITSSLRSVCEWGHKVNP
PTDINPLHADLLLYITRFDLVLPSGNKLVRGVTQLGGVCSSQWNCVITEDTGFDLGITIA
HEIGHSFGINHDGIGNTCSSGGFIMASDGGYNSVDLTWSQCSKAQLLNFYSAGKAECVKN
VPELGGSLQGWKPGLYYGVDDQCRIAFGSTATACSFASNDMATCRALSCHIIPGDGSSCT
RLLVPLLDGTECGPNQWCLKGQCVSPSKLSSSMVVHGSWSAWSTFSPCSRTCGGGVTFRK
RACNNPRPAFGGRECVGEDTEAELCHRQSCKCNQLEFMAQQCSDADHQPLSVSPYSASVY
SWIPAIGFTSGDAQCKLTCRSSQEDFLVSRGARFVDGTRCEPDNPVPAGSVTACLSGKCQ
LFGCDGVLNSGKMEDVCGVCGGNGSTCQHISGTYTGGDTKEYVTFLVLPVNASRVRVTNW
NPLFTHLAVLVNDEYVVAGNGDMALNTTQPSPLEESRVIYRLYLTSELLPHQEDLTLSGP
ITDKIHIQVYIKYGKEYGDITSPNITYEYYVPESIPLEEVIKGQWANVISPCSVTCGSGV
QWVSQVCVDVGTQEHLEEQLCGSAPPSPRVPQPCWLPDCPASWVVGEFGSCSAPCGVGER
VRSVTCMQKQGAETMLLQDFDCPQVTKPPVTEACNTQLCPARWRVSEPEECSAVCGPGEA
RRTVSCIRFHRGANTKIDNALCPQPSPPEYVRCVVDVCPIGWETHGEAQKNHSLLLPLMP
RPKADSVYVWSPVIGHCAKTCGNGTQQIWFSCVDHQSRLDVPEFLCDRFSKPEPYTQRCA
QSPCPVMWRYMQGRCSVSCGGGVARRVLYCAQQAAEGEGTREVVLADSDCLAAPRPLEVV
VCNTDACPTRWQVGDQSPCSVSCGLGVATRRVWCVRFDGGEEREVGGESCEATRKPPLRV
PCFTQACSFYWAVEEWNECSMSCGYGIQSRTVSCLGPSSLLPVSLLLCAHLPKPITIQAC
HRSECSLSSSPTQGPGHPPNQAPAPAPWSKQKKRRLLDLGKKAALAPAERTEMSGRIGGV
LPTEPHTATVVESTTAPPTQPSLSSLCGELFLKDVGTIDLRNVTERRCFIAIGRPLDEVI
QIKIESSSLNCRHKESLALYERLSLRRFCEKVAGKLVTSRSNVLLVRQSRLTPGSGVVLS
YQSTKNPKESHREDCDVQLFSPSGLIENSVRSSASSSNSSTQSCRVFIDAPPALRIQIRA
LSVLNTTSPDSTYVLIRDVDAVKTKVFRGTQLFLWMSTGSRAEVEFQGEYKHMKGSFRAE
YFYVKPGEPKLI
NT seq 4359 nt   +upstreamnt  +downstreamnt
atggcagctcttttgttactctttctgacttcacttatggtggacaaggctttgctgacc
tctcagttttcccttgaaaagcaaggcctgatcctcttctattcagagaatagaaagcta
catattcgtccactgctccaaatccattcagaccacttgagaagcagcgtagacagaccc
ccaggtctaccacacctggtgtggtaccgcccctcacctgttgggccacgcccgagacag
tcacatagtcatcataggttacggagagcacttactggggctcagctcactcatttagag
ctgctggtggtggttggccctgatgtctacgaggttcacaaacaggacaccgagagatac
atcctcaccaatctgaacattgcttcagagctgttaagagacgtcaccctgggagcgaac
atgagagttcacctcgtccgcatgatcattcttactgagccggagccagagattcacatc
tctgacaacattacctcctctctaaggagtgtttgtgagtggggtcataaggtcaacccc
ccaactgatatcaacccactgcatgcagatttactactgtatattacaaggtttgatctg
gtactgcccagtggaaataaactggtgaggggtgtgacccagttgggcggagtctgttct
agccaatggaactgtgtaattacagaagatacaggttttgaccttggaatcaccattgca
catgagattggacacagttttggcataaatcacgatggcattggtaacacctgcagcagt
ggtgggtttataatggcatccgatggcggttacaacagtgtggatctcacatggtcccag
tgcagcaaagcccagctccttaacttctacagtgcaggtaaggccgaatgtgtgaagaat
gttccggagctgggaggctcgctgcaggggtggaagccaggcctgtattacggcgtggat
gatcagtgtcgcatcgcgtttggcagcacagccactgcctgctcttttgctagcaacgac
atggcaacctgtcgtgccctgtcttgccatatcatccctggcgacggcagctcatgcacc
cgactgcttgtgccgctactggacggtaccgagtgtgggccgaaccagtggtgcttgaag
ggccaatgtgtgtctccatccaagctgagctcctctatggtggtccatggctcctggtca
gcctggtccaccttctccccctgctcacgtacctgtggaggcggggtcactttccgtaag
agagcgtgtaacaaccccaggccagcgtttggagggagagagtgtgtcggagaggacacc
gaggctgaactttgtcatcgacagtcatgcaagtgcaaccagcttgagttcatggcccag
cagtgctcagatgcagaccaccaacccctctcagtctctccctattcagcctctgtctac
tcctggatacctgcaattgggttcacttcaggtgatgctcagtgtaagctgacatgtcgc
tccagtcaggaggacttcttggtgagccgcggggcccggtttgttgatgggacgcggtgc
gaacccgacaaccctgtgcctgccggctcagtgactgcttgcctcagtggaaagtgccag
ctgtttggttgtgatggagtgttgaactctgggaagatggaggatgtgtgtggcgtttgt
ggtggaaatggctccacctgccaacatatctctgggacctacacaggtggagacaccaaa
gagtatgtgactttcctcgtactgccggtgaatgcctctcgggttcgtgtgactaactgg
aacccacttttcacacatctggcggtgctggtaaatgatgaatatgtggtggctggaaat
ggggacatggcactaaacaccacgcagccctcgccgctggaagaaagtcgtgtgatttac
cgcctctacctcacgtccgagctcctgcctcaccaagaggacctcaccctgtcaggacca
atcacagacaagatccacatacaggtatatataaaatatgggaaggagtatggagacatc
acaagtccaaacatcacctacgagtattatgtgcctgagagcattccattggaagaagtc
atcaagggccagtgggctaatgtcatatcaccctgttctgttacctgtggctcaggggtc
cagtgggttagtcaggtgtgtgtcgatgtggggacacaggagcacctggaggagcagctc
tgtggttcagctcctccaagcccaagggttccacagccctgctggctgcctgattgccca
gccagctgggtggtcggtgagtttggttcctgcagcgccccctgtggtgtgggggagcgg
gtgcgctctgtgacctgcatgcagaagcagggggcagaaacgatgctgctgcaggatttc
gattgccctcaagtgactaaacctccagtaacagaggcctgcaacacccagctttgtcct
gcgaggtggcgagtctcggagcccgaggagtgttctgcagtgtgtgggccaggtgaggcc
cgcagaacagtatcttgcattcgcttccaccgtggagccaataccaagatcgacaacgcc
ctctgcccccaacccagcccgcctgagtatgtgcgctgtgtggtggatgtatgccctata
ggctgggagacacacggagaggctcagaagaaccatagcctgttacttcctctaatgccc
cgacctaaagcggattcagtgtatgtgtggagtcctgtgattggccactgcgctaagact
tgtgggaatggcacacagcagatatggttctcatgtgtggatcaccagtcacgtttggat
gtcccagagttcctctgtgaccgcttcagcaagcctgagccatatacgcagcgctgtgcc
caatcaccatgccctgttatgtggcgatatatgcagggtaggtgcagtgtgtcttgtgga
ggtggtgtagcaaggagggtgctctactgcgctcagcaggctgcagagggagaggggacc
agggaggtggtgctagccgactctgactgtctggctgcaccgaggcctctggaggtggtg
gtgtgcaacactgacgcctgtcctacaaggtggcaggtgggagatcaatctccctgttcg
gtgtcttgcggtctgggcgtggcgacgaggagggtctggtgtgtgcgcttcgatggcggg
gaggagcgagaggttgggggggagagttgcgaggcaactaggaagcctcctctcagggta
ccctgcttcactcaggcctgctccttctactgggctgtagaggagtggaacgagtgttcg
atgtcatgtggctatgggatccagtctcgaacagtctcatgccttggcccgtccagcctg
ctacctgtcagccttctcctatgtgcccaccttcccaaacccatcaccatccaggcttgc
catcgctccgagtgctccttatcctccagtcccacccaggggccgggccaccctcctaac
caggcaccggcaccggcaccctggagcaagcagaagaagaggaggctcctggatctggga
aagaaggccgcattggcacctgctgaaagaactgagatgagtggaaggattggtggtgtt
ttacccacagagccacatacagcaacagtggtggaaagcaccacagcgccaccaacacag
ccctccttgagcagtttgtgtggggaactcttcctcaaggatgtgggaaccattgaccta
cggaacgtcacggagagaagatgtttcattgctattggacgtcctcttgatgaggtcatc
caaatcaaaatcgagtcaagctctcttaactgcaggcacaaggagagtcttgccctttat
gaaaggctatctttgaggcgattttgtgaaaaagtggcaggaaagttggtgacatctcgc
tctaacgtcctattggtgcggcaaagccgcctcacgcctggcagcggagtggtgctgtcc
tatcagagcacaaagaatccgaaagaaagccatcgcgaagattgtgacgttcagctgttc
tctccatcgggtctgattgagaactcggtcaggagttcggcatcctcgtccaattccagt
actcagtcttgtcgagtgttcattgatgctccgcctgccctgagaatacagatcagagcc
ctgtctgtgctcaatacaacctctccagactccacatacgtgctgattcgggatgtggat
gctgtgaaaaccaaagtcttcagagggacacagctcttcttgtggatgtccacagggagt
agggcagaagtagaattccagggcgaatacaagcacatgaaaggatcattcagggcggaa
tatttctatgttaagcctggggaacctaaattaatttag

DBGET integrated database retrieval system