KEGG   Electrophorus electricus (electric eel): 113578233Help
Entry
113578233         CDS       T05787                                 

Gene name
nmnat2
Definition
(RefSeq) nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2
  KO
K06210  nicotinamide mononucleotide adenylyltransferase [EC:2.7.7.1 2.7.7.18]
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee00760  Nicotinate and nicotinamide metabolism
eee01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eee00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    113578233 (nmnat2)
Enzymes [BR:eee01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     113578233 (nmnat2)
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     113578233 (nmnat2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTP_transf_like
Motif
Other DBs
NCBI-GeneID: 113578233
NCBI-ProteinID: XP_026867173
Position
Unknown
AA seq 306 aa AA seqDB search
MTETTKTHVILLSCGSFNPITKGHIHMFEKAREYLHKTGRFIVIGGIISPVHDSYGKPGL
VPSRHRLNMCQLAVQSSDWIRVDPWECYQDTWQTTCSVLEHHRDLMKRVTGCILSNVNSP
STTPVIGQPQNTTSAICQNRNTVDKPTAIKLWGKMSESLGKICCVRPPVERFTFVDENAN
LGTAVRYEEIELRILLLCGSDLLESFCIPGLWNESDMEVIVGDFGIVVVPRDRADTERIM
NHSSILRKYKDNIIVVKDDLNHPMSVVSSTKSRLALQHGDGHVVEYLSQPVIDYILQTQL
YINASG
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgacagagaccaccaaaacgcacgttattttgctgtcatgtggaagttttaaccccatc
acaaagggacacattcatatgttcgaaaaagccagagagtatctacataagacagggcga
ttcattgtgattggtgggatcatctcacccgtacacgactcctatggcaaaccaggtctt
gtgcctagcagacaccgcctcaacatgtgtcagttggcagtgcagtcctctgattggatc
agggtggacccatgggagtgttatcaggacacctggcagacaacctgcagtgtgctggaa
catcaccgagatctcatgaagagagtgacaggatgtattctttcaaacgtgaactctccc
tccacgactcctgtcattggccagccccagaacaccacttctgctatctgtcagaaccgc
aacacagtggacaagcccacagccattaagctctggggcaagatgagtgagagtctgggc
aaaatctgctgcgttcgcccccctgtggagcgcttcacttttgttgatgagaacgccaac
ctcggcactgcagtgcgctatgaggagattgagttgcgtatcctgctcctgtgtggcagt
gatctgttagagtctttctgcattccaggtctgtggaatgaaagtgatatggaggtgatt
gtgggggattttggaatagtggtggtcccacgagacagagccgacacagaacggataatg
aatcactcctctatcctccgcaagtacaaggacaacatcatcgtagtgaaggatgatctc
aaccatccaatgtcagttgtcagttcaacaaagagcagactggctctccagcatggagat
ggccatgtggtggaatacctgtctcagcctgtgattgactacatcttgcagactcagctc
tacatcaacgcctccggatag

DBGET integrated database retrieval system