KEGG   Electrophorus electricus (electric eel): 113579035Help
Entry
113579035         CDS       T05787                                 

Definition
(RefSeq) heat shock cognate 71 kDa protein-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee03040  Spliceosome
eee04010  MAPK signaling pathway
eee04141  Protein processing in endoplasmic reticulum
eee04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:eee00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    113579035
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113579035
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113579035
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113579035
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:eee01009]
    113579035
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:eee03041]
    113579035
   03009 Ribosome biogenesis [BR:eee03009]
    113579035
   03110 Chaperones and folding catalysts [BR:eee03110]
    113579035
   04131 Membrane trafficking [BR:eee04131]
    113579035
   03051 Proteasome [BR:eee03051]
    113579035
   03029 Mitochondrial biogenesis [BR:eee03029]
    113579035
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eee04147]
    113579035
Protein phosphatases and associated proteins [BR:eee01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     113579035
Spliceosome [BR:eee03041]
 Complex B
  Other components
   Prp19 complex
    113579035
 Complex C
   Prp19-CDC5 complex
    113579035
Ribosome biogenesis [BR:eee03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    113579035
Chaperones and folding catalysts [BR:eee03110]
 Heat shock proteins
  HSP70 / DNAK
   113579035
Membrane trafficking [BR:eee04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    113579035
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    113579035
Proteasome [BR:eee03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    113579035
Mitochondrial biogenesis [BR:eee03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    113579035
Exosome [BR:eee04147]
 Exosomal proteins
  Proteins found in most exosomes
   113579035
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MAP7
Motif
Other DBs
NCBI-GeneID: 113579035
NCBI-ProteinID: XP_026868493
Position
Unknown
AA seq 240 aa AA seqDB search
MTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPR
GVPQIEVTFDIDANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAED
DVQRDKVSAKNGLESYAFNMKSTVEDEKLKGKISDEDKQKILDKCNEVISWLDKNQTAER
EEYEHQQKELEKICNPIITKLYQSAGGMPGGMPDGMPGGFPGAGAAPGGGSSGPTIEEVD
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgactgttctcatcaagcgcaacaccaccattccaaccaagcagacccagacttttacc
acatactctgataaccagcctggtgtgctgattcaggtctatgagggtgagcgtgccatg
accaaggacaacaacctgctgggcaagtttgagctcactggaatcccccctgcccctcgt
ggtgttccccagattgaggtcacttttgacatcgatgctaatggcatcatgaatgtctct
gctgtcgacaagagcactggcaaggagaacaagatcacaatcaccaatgacaagggtcgt
ctcagcaaggaggacattgagcgcatggtgcaggaggctgagaagtacaaggctgaggat
gatgtgcagcgtgacaaggtgtctgccaagaatggcctggaatcctatgctttcaacatg
aaatccactgtggaggatgagaagctgaagggcaagatcagtgatgaggataagcagaag
atcctggacaaatgcaatgaggtcatcagttggcttgacaagaaccagactgctgagaga
gaagagtatgagcaccagcagaaggagctggagaagatctgcaatcccatcatcaccaaa
ctgtaccagagtgctgggggcatgcctggtgggatgcccgatgggatgcctggaggattc
ccaggagctggagctgcacctgggggtggatcttctgggccaaccattgaggaggttgat
taa

DBGET integrated database retrieval system