KEGG   Electrophorus electricus (electric eel): 113579250Help
Entry
113579250         CDS       T05787                                 

Gene name
phf6
Definition
(RefSeq) PHD finger protein 6
  KO
K23310  PHD finger protein 6
Organism
eee  Electrophorus electricus (electric eel)
Brite
KEGG Orthology (KO) [BR:eee00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:eee03000]
    113579250 (phf6)
   03009 Ribosome biogenesis [BR:eee03009]
    113579250 (phf6)
   03036 Chromosome and associated proteins [BR:eee03036]
    113579250 (phf6)
Transcription factors [BR:eee03000]
 Eukaryotic type
  Zinc finger
   Cys4HisCys3 PHD fingers
    113579250 (phf6)
Ribosome biogenesis [BR:eee03009]
 Eukaryotic type
  Other ribosome biogenesis factors
   113579250 (phf6)
Chromosome and associated proteins [BR:eee03036]
 Eukaryotic type
  Chromatin remodeling factors
   NuRD complex
    113579250 (phf6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-HC5HC2H zf-HC5HC2H_2 PHD
Motif
Other DBs
NCBI-GeneID: 113579250
NCBI-ProteinID: XP_026868853
Position
Unknown
AA seq 364 aa AA seqDB search
MSGQRKGAVGRLRKCAFCRTNREKECGQLLVSDNQRVAAHHKCMLFSSALVTSHSDSENI
GGFSVEDVKKEIKRGNKLMCSSCHRPGATIGCDVKTCRRTYHYYCALWDKAQTKENPSQG
IYLVYCRKHRDASQEASDEEQGVAANDSDSSPPRNRGRGRFEKSRIRAVSRGQSDDARST
SSQGLDEMESSSNRDRSPLRGSLSESGLRCGFCHAGDEENQTRGVLHSDNAKKVAAHYKC
MLFSSGTVQLTTTSRAEFGNFDIKTVIQEIKRGKRMKCTLCGQLGATIGCEIKACVKTYH
YHCGLQDKAKYIENMARGIYKLYCKNHSGNEERDEEDEERESRSRERAASNHEGTSSPSQ
VNGN
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgtcagggcaaaggaaaggtgcagtggggcgtctgagaaagtgtgccttctgtagaact
aaccgagagaaggagtgtggccagcttctagtatcagacaaccagagggtggcagcccac
cacaaatgtatgcttttctcatctgccctggtgacctctcattcagacagtgaaaacatt
gggggattttctgttgaggatgtgaagaaggagatcaaaagaggaaacaaattgatgtgc
tcttcttgccaccggcccggggctaccataggctgcgatgtaaagacgtgtcggcggacg
taccactactactgtgccctatgggacaaggcacagaccaaggagaacccctcccaggga
atttacctagtttactgtcgtaagcatcgcgacgcctcccaagaagccagcgatgaggag
caaggagtcgcagccaacgattccgattcctccccgccaaggaacagaggaagggggagg
tttgagaagagccgaatccgagccgtgtctcgtggccaatcggacgacgcccgctcgacc
tcgtcgcaagggctggatgaaatggaaagctcctcaaatcgggaccggtcccctctgagg
ggcagcctgagtgagtcagggcttcgttgtggtttctgccatgctggcgatgaagagaat
cagacacgtggtgtgctgcattctgacaatgcgaaaaaggtcgccgcccactacaaatgc
atgcttttctcttcgggaactgtccagctcactacaacctcacgtgcagaatttgggaac
tttgacattaaaacagtcattcaggaaataaagagaggaaaaagaatgaaatgcaccctg
tgtggccagcttggagccaccattggctgtgagataaaagcctgcgtgaaaacctaccat
tatcactgtggcctgcaggacaaggccaaatacatagagaacatggcccgaggcatatac
aaactgtactgtaagaatcacagtggaaatgaggaacgggatgaagaggatgaggaaagg
gagagtcggagtcgcgagagggctgccagcaaccatgagggaacgtcttctccatcccaa
gtcaatggcaactag

DBGET integrated database retrieval system