KEGG   Electrophorus electricus (electric eel): 113579496Help
Entry
113579496         CDS       T05787                                 

Gene name
minpp1
Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1 isoform X1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee00010  Glycolysis / Gluconeogenesis
eee00562  Inositol phosphate metabolism
eee01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eee00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    113579496 (minpp1)
   00562 Inositol phosphate metabolism
    113579496 (minpp1)
Enzymes [BR:eee01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     113579496 (minpp1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     113579496 (minpp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF4708
Motif
Other DBs
NCBI-GeneID: 113579496
NCBI-ProteinID: XP_026869275
Position
Unknown
AA seq 464 aa AA seqDB search
MKPVHLVSRNKHFVMAALSIVMAHVSYSKLTVPAIATYFGTKCRYEDVNLHLRDDILFVN
KSLMGPPSAACKAVHLVAVLRHGTRYPTAKNIRKLASLYDLVMAEASGPAWWLDGIKSNW
TMWYTEDMDGKLVTKGKEDHRHLAIRLAKTFPTLMSRDNLLGERIEFLTSSKHRCVDSVK
AFQEGLHQHLDVRGLGFTHYVNDSLMRFFDQCQRFVEDVENSKTALKEVEIFKTSVEMEG
VRRKMASRLQIPHSLITSGYFKNLVEAAFFLCSYELAIKSENSLWCNTLDEVDAEVLEYK
NDLKQYWKRAYGYDINRKSSCSLFHDLFRRLEEASHYYRLGKATKAATVQVGHAETLLPL
LSLMGFFRDKTPLTAENFSVQRGRKFRTSQIVPYAANLLFVLYECRDELRLQFFLNEKPV
QFPSIGHPAPLYDTVRAHYSKLLQGCDFNKECELPKVNHMNTEL
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccagtacatttagtgtccagaaacaaacattttgttatggctgctttaagcatt
gtaatggctcacgtgtcgtacagtaaattaactgtaccagcaattgctacttactttggc
acaaaatgcagatatgaagacgtgaacttacatttaagggacgatattttattcgtaaat
aaatctctcatgggacccccatccgctgcctgcaaggcagtacacttagtggcagtactc
aggcacggaacacgctatcccacagccaagaatattagaaagctcgcaagcctgtacgat
ctggttatggccgaggcgtcagggcctgcctggtggctggatggcattaaaagtaattgg
acaatgtggtacacagaggacatggacggcaagctagtaacgaaaggaaaggaagaccac
agacatttggctataaggttggccaaaacattcccgacgctgatgtcccgggataacctt
cttggtgaacgcattgagtttctgaccagctctaagcacagatgcgttgatagcgtcaag
gcattccaagagggccttcaccaacacctggatgtgcgaggcttgggcttcacacactat
gtgaatgattcactaatgagattctttgatcagtgccaaagatttgttgaagatgttgag
aacagcaagacagcgctgaaggaggttgaaattttcaagacatctgtagagatggaagga
gttaggaggaagatggccagtcgcttacagattccacacagtctaataacatcaggttac
tttaaaaatttagttgaagcagctttcttcctgtgctcttatgagctggcaatcaagtct
gagaattctttatggtgtaatacgctggatgaggtggatgccgaggtccttgaatacaaa
aatgatttgaaacagtattggaaaagagcctatggctatgacatcaaccgcaaatcgagt
tgttccctctttcatgaccttttcagacgactggaggaagcttcacattactacaggctc
ggcaaggctaccaaggcagccaccgttcaggttggccatgcagagactctgctcccgctg
ctctctctgatggggttcttccgggacaaaacgccgctgaccgctgagaacttctcagtg
cagcgcggccgcaagtttcgcaccagtcagatcgtcccttacgcggctaacctgctcttc
gtcttgtatgagtgtagggatgaactgagactgcagttctttctcaatgagaaaccagtg
cagttccccagcataggtcacccagccccactctatgacacagtcagggcccactactcc
aaactcctgcaaggctgtgattttaacaaagaatgtgaactgcccaaagttaatcacatg
aacacagaactatga

DBGET integrated database retrieval system