KEGG   Electrophorus electricus (electric eel): 113580512Help
Entry
113580512         CDS       T05787                                 

Gene name
sephs1
Definition
(RefSeq) selenide, water dikinase 1
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee00450  Selenocompound metabolism
eee01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eee00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    113580512 (sephs1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:eee03016]
    113580512 (sephs1)
Enzymes [BR:eee01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     113580512 (sephs1)
Transfer RNA biogenesis [BR:eee03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    113580512 (sephs1)
 Prokaryotic Type
    113580512 (sephs1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-GeneID: 113580512
NCBI-ProteinID: XP_026870916
Position
Unknown
AA seq 392 aa AA seqDB search
MSVREAFNPESYELDKNFRLTRFTELKGTGCKVPQDVLQKLLESLQENHYQEDEQFLGAV
MPRLGIGMDTCVIPLRHGGLSLVQTTDYIYPIVDDPYMMGRIACANVLSDLYAMGVTECD
NMLMLLGVSNKLSEKERDKVMPLIIQGFKDASEEAGTSVTGGQTVLNPWIVLGGVATTVC
QPNEFIMPDNAVPGDVLVLTKPLGTQVAVAVHQWLDIPEKWNKIKLVVTQEDVELAYQEA
MLNMARLNRTAAGLMHTFNAHAATDITGFGILGHAQNLARQQRSEVSFVIHNLPVLAKMA
AVSKACGNMFGLMHGTCPETSGGLLICLPREQAARFCAEIKSPKYGEGHQAWIIGIVEKG
NRTARIIDKPRIIEVAPQVATQNVNTTPGTTS
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtgcgggaggcttttaatccagagagttatgagctggataaaaacttcaggctg
acacgcttcacagagctcaagggcactggctgcaaagtgcctcaggatgtgcttcagaaa
cttctggagtctttgcaggagaatcattatcaggaagatgagcagttccttggagcagtt
atgcccagactgggcattggcatggacacctgtgtaattcccctgagacatgggggactt
tcattagtgcagacaacagactacatttaccctatagtagatgacccatatatgatgggc
agaatcgcatgtgccaacgtcttgagtgacctatatgctatgggagtgactgagtgtgat
aatatgttgatgctgttgggtgttagtaacaaactctcagaaaaggagcgagacaaggta
atgccgctgattatccagggttttaaggatgcatctgaagaagctggaacctcagtgact
ggtggtcagactgtgcttaacccatggatagtccttgggggtgtggctacaactgtgtgc
caaccaaatgagttcattatgccagataacgcagttccaggtgatgtcctggttcttacc
aaacctctgggcactcaggtggctgtagcagtgcatcagtggctggacattccagagaaa
tggaacaagattaagttagtagtaacccaggaggatgtggagctagcttatcaagaggcc
atgctaaacatggccagactcaacagaacagcggcgggtctgatgcacacatttaatgca
cacgctgccactgacatcacgggtttcgggatcttggggcatgctcagaacctcgcccgg
cagcagcgaagtgaggtctctttcgtcattcacaacctgcctgtcctcgccaagatggct
gctgtgagcaaagcctgtggaaacatgttcggcctcatgcacggcacctgcccagagacc
tcaggaggcttgctcatctgtcttccacgggagcaagctgcacgattttgcgctgagatc
aagtcccctaaatacggcgagggccaccaggcatggatcatcggcatcgtggagaagggc
aaccgcacggctcgcatcattgacaagccacgcatcatcgaggttgccccgcaggtggct
acgcagaacgtcaacaccacaccaggaacgacgtcctaa

DBGET integrated database retrieval system