KEGG   Electrophorus electricus (electric eel): 113580614
Entry
113580614         CDS       T05787                                 

Definition
(RefSeq) retinol dehydrogenase 7-like isoform X1
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:eee00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    113580614
Enzymes [BR:eee01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     113580614
SSDB
Motif
Pfam: adh_short adh_short_C2 DUF1776 KR
Other DBs
NCBI-GeneID: 113580614
NCBI-ProteinID: XP_026871098
Position
Unknown
AA seq 332 aa
MDMEQIYEYIGKEHVTYAIGACVLLWIFVWLYRDSLKIDRICEKYVFVTGCDSGFGHLLC
RKLDKHGFRVLAGCLTETGADDLKRVTGPYLKTCILDVTSTASIQKALEWTQEEVGDKGL
WGIVNNAGRSLPMGPSEWMRIEDFQSTLRTNLIGVIETTMNFLPIVKKARGRIVNIASVL
GRVGVNGGGYCISKSGVESFSDCLRRDIQCFGIKVCIIEPGFFKTQMTSLQPLEKELHRL
WQQLTPEVKDSYGEKYLEKYIKIQRVIMNAICDSDLSRVTNCMEHALTAAHPRTRYSPGW
DAKLLWIPLSYMPSCVVDIGLRLVMPRPAKSI
NT seq 999 nt   +upstreamnt  +downstreamnt
atggacatggaacaaatatatgaatatataggtaaggaacatgtaacatatgctattggt
gcatgtgtgctgctgtggatctttgtatggctgtaccgggacagtctgaagattgacagg
atctgtgagaagtacgtgtttgtcaccggctgtgactccggcttcggtcacctattgtgc
aggaagctggacaaacatggttttcgtgtcctggctggctgtcttacagaaacgggggcc
gatgacctgaagcgggtcacgggcccctatctgaagacttgcatactggatgtgaccagc
actgcaagcattcagaaagctttggaatggacacaggaggaggttggagataaaggacta
tggggcatagtgaacaatgcgggccgatctctacccatgggtccctctgagtggatgcgc
atagaggacttccagagcactctgaggacaaacttgattggtgtgattgagacaaccatg
aacttcctgcccattgtcaaaaaggcccgcggccgaatcgtcaacatagcgtctgtgctg
ggcagggttggagtgaacggaggcggctactgcatctccaagtctggggtggaatccttc
tctgactgccttagaagggatattcagtgttttgggattaaagtttgtataattgaacct
ggattcttcaagacacagatgacaagcctgcaaccacttgaaaaggagcttcaccgcctt
tggcaacaactgactccagaagtaaaggatagttatggagaaaaatatctggagaagtat
atcaagatacagagagttattatgaatgctatttgtgacagtgatttgagcagagtgacc
aactgcatggagcatgctttgacagctgctcatccaaggacccggtacagtcctggctgg
gatgccaagctgctctggatcccgctttcctacatgccatcctgtgttgttgacattggg
ctaaggcttgtgatgccccgtccagcgaagagcatatag

DBGET integrated database retrieval system