KEGG   Electrophorus electricus (electric eel): 113581160Help
Entry
113581160         CDS       T05787                                 

Gene name
utp18
Definition
(RefSeq) U3 small nucleolar RNA-associated protein 18 homolog
  KO
K14553  U3 small nucleolar RNA-associated protein 18
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:eee00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    113581160 (utp18)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:eee03009]
    113581160 (utp18)
Ribosome biogenesis [BR:eee03009]
 Eukaryotic type
  90S particles
   U3 small nucleolar RNA-associated proteins
    113581160 (utp18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PQQ_2 Formyl_trans_C Gmad1 PQQ_3
Motif
Other DBs
NCBI-GeneID: 113581160
NCBI-ProteinID: XP_026871915
Position
Unknown
AA seq 526 aa AA seqDB search
MDSFMPVVKKCKKKSKRTLYNVLEPVNFKQEEIKRKKHTRLIKVLGEEDESVKLLEDLVF
GAEEELVERLGVGSEEDSSAEASGDSEPEAESRLQCPAERKAVWEDEDDGVIEEVDMTQR
FREDLKKSDAESRMTNQKLQQRLKEQFQKAMGGTPSWADSSLRKSKKKRDNEEEEGDEEE
DDEDTEILRKTGNYVGTSTSLPKGIIKLKKCLNANNEKPGEDRLTTVQFHPSAQVIMTAG
LDHSISLFQVDGKSNPKIQSIHLEKFPVNKACFSANGEQVVATGMRNKLFYIYDMMEGKV
LPVPSVQGLNEQRVKEFEVSPDNEFLLLTGSSGFLHLMTMKTKEVVRSMKLNGNVCATAF
TADGGKVFAHSEEGEVYVWDVRSSKCLNRFVDDGCVRGTSLAVSREGLYVACGSQSGVVN
IYSQRACLQDPAPKPLKAVMNLLTPATSLRFNPTSEILAIASRAADEATRLVHIPSFTVF
SNFPMFRRKTIYRAHCLDFSPNSGFYSVANNKGHAVLFRLLHYKDF
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggattcgtttatgcctgtcgttaaaaaatgcaaaaaaaagtcgaagaggactttgtat
aatgtcttggagcctgtgaattttaaacaagaggaaataaaacgtaaaaaacacacacgt
ttaataaaggtacttggtgaagaagatgaatccgtaaagcttctcgaagatctcgttttt
ggcgccgaggaagaactggtagaacgtcttggagtggggagtgaggaagacagcagtgcc
gaagcttcaggagactcggagccagaggctgagtctcgtcttcagtgtcctgcagaaaga
aaggctgtgtgggaggatgaagacgatggtgtgattgaagaggtcgacatgacacagcgg
tttcgtgaagaccttaagaagagcgatgcagaatccagaatgaccaatcagaagctccag
cagcgactgaaagagcagttccagaaagcaatgggtggaactccatcttgggctgacagc
agtttaaggaaaagtaagaaaaaaagagataatgaagaggaggagggtgatgaagaagag
gatgatgaggacacagagatattaagaaagactggcaactacgttggcacatctacaagc
cttcctaaagggattattaagctgaaaaagtgtctcaacgccaacaacgagaagccgggt
gaggaccggctcaccactgtgcagttccacccctctgctcaggtcatcatgacagcagga
ttggatcactccatctccctcttccaggttgatgggaaaagtaaccccaagatccaaagc
atccacctggagaaatttccagtgaataaggcctgcttcagtgccaatggtgagcaggtg
gttgccactggcatgaggaacaagctcttctacatctatgacatgatggaggggaaagtt
ctccctgttccctctgttcagggcctgaatgagcagagggtgaaggagtttgaggtttct
ccagacaacgagtttctcctgctcaccggttcctctggcttcctccatctcatgactatg
aagacaaaggaggtggtccgaagcatgaagctgaacggcaacgtgtgcgccacagcattt
accgccgatggcggcaaagtattcgcccactcagaggaaggtgaggtgtatgtttgggac
gtgcggagcagtaaatgcctgaatcgctttgtggatgatggctgtgtgagggggacgtct
ctcgctgtgtccagggaaggcctgtatgtggcctgtggctctcagtctggtgtggtgaac
atctactcccagagggcctgtctgcaggaccctgctcccaaaccactcaaagctgtgatg
aacctgctaactcctgccacctcactgcgcttcaaccccacctcagagattttagccatc
gcctcccgtgccgctgacgaagctacccggctggtccacattccaagctttacagttttc
tccaacttcccaatgttccggaggaagactatctaccgagcacactgcctcgacttctct
cccaacagtggcttctactcagtggccaacaacaaaggccatgctgttctgttcagactg
ctgcattataaagacttctga

DBGET integrated database retrieval system