KEGG   Electrophorus electricus (electric eel): 113581248Help
Entry
113581248         CDS       T05787                                 

Definition
(RefSeq) sodium/potassium-transporting ATPase subunit alpha-3 isoform X1
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee04260  Cardiac muscle contraction
eee04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:eee00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    113581248
   04261 Adrenergic signaling in cardiomyocytes
    113581248
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eee04147]
    113581248
Enzymes [BR:eee01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     113581248
Exosome [BR:eee04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   113581248
  Exosomal proteins of other body fluids (saliva and urine)
   113581248
  Exosomal proteins of colorectal cancer cells
   113581248
  Exosomal proteins of bladder cancer cells
   113581248
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3 DUF1290
Motif
Other DBs
NCBI-GeneID: 113581248
NCBI-ProteinID: XP_026872054
Position
Unknown
AA seq 1022 aa AA seqDB search
MGYGRSDSYRVATTTDNDEKDSPKKKGGKDLDDLKREVPLTEHKMSVEEVCRKYNTDIVQ
GLTNARAAEYLARDGPNALTPPPTTPEWVKFCRQLFGGFSILLWIGAILCFLAYAIQAVT
EDEPAGDNLYLGIVLSAVVIITGCFSYFQEAKSSKIMESFKNMVPQQALVIREGEKLQIN
AEEVVAGDLVEVKGGDRIPADLRIISAHGCKVDNSSLTGESEPQTRSPDCTHDNPLETRN
IAFFSTNCVEGTARGIVVCTGDRTVMGRIATLTSGLETGKTPIAKEIEHFIHIITGVAVF
LGVTFFILSIILGYSWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNL
EAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTEDQSGTSFDKTSVTWVSL
ARVAALCNRAVFKAGQESLPILKRDVAGDASESALLKCIELSCGSVKAMRDKNKKVAEIP
FNSTNKYQLSVHETEDSKNTPYLLVMKGAPERILDRCSTIMLQGKEQPMDEEMKEAFQNA
YLELGGLGERVLGFCHLFLPEDKYPKGFAFDTDDVNFQTDNLCFVGLMSMIDPPRAAVPD
AVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAK
ACVIHGSDLKDLTQEQMDEVLKNHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVND
SPALKKADIGVAMGISGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLT
SNIPEITPFLFFILVNIPLPLGTITILCIDLGTDMVPAISLAYEAAESDIMKRQPRNPLR
DKLVNERLISIAYGQIGMIQALGGFFAYFVIMAENGFLPSLLVGIRLNWDDRSNNDLEDS
YGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADVIICKTRRNSVFQQGMKNKILIFGLFEE
TALAAFLSYCPGMDVALRMYPLKPSWWFCAFPYSFLIFVYDEIRKLILRRNPGGWVEKET
YY
NT seq 3069 nt NT seq  +upstreamnt  +downstreamnt
atggggtatggacggtcggacagctaccgtgtggcaaccacgacggacaatgatgaaaag
gactctcccaagaagaagggagggaaagatctggatgacctcaagagagaagtaccgctg
acagaacataagatgtctgttgaggaagtgtgccgaaagtacaacactgatattgtgcag
ggtctgactaatgccagggcagcagagtacctggctcgggatggtcccaatgcactcacc
cctccccccaccaccccagagtgggtcaagttctgccgccagctctttgggggcttctcc
atcctgctgtggatcggagctatcctctgcttcttggcctatgccatccaggcagtcact
gaagatgagccagctggagacaatctgtacctgggtatagtgctgtctgcagtggtcatc
attaccggctgcttctcctacttccaggaggcaaagagctcaaagattatggagtctttc
aagaacatggtgccccagcaagcattagtgatccgtgagggtgaaaagttgcagatcaat
gctgaggaggtggtggcgggagatctggtggaggtgaaaggaggagacaggatccctgct
gaccttcgaattatctctgctcatggttgcaaggttgacaactcctctctgaccggcgag
tcagagcctcagacgaggtcacctgactgtacccatgacaaccccctggaaacccgcaac
atcgcctttttctccaccaactgcgtggaagggacagcccgtggtatcgtggtgtgcact
ggagaccgcaccgtcatgggccgtatcgccactctcacctcgggcctggagacgggcaag
acacccattgccaaggagatcgagcattttatccacatcatcacaggcgtggccgtcttc
ttgggcgtcaccttcttcatcctgtcaatcattcttggctacagctggctggaggccgtc
atcttcctcatcggcatcattgtggccaatgtacccgaggggctcctggccaccgtcact
gtttgtctgacccttacagctaagcgtatggctcgtaagaactgcctggtgaagaacctg
gaagctgttgagacactgggttccacctccaccatctgctcggacaagacgggcaccctg
acgcagaaccgcatgaccgtggcccacatgtggtttgacaaccaaatccatgaggccgac
accactgaggatcagtcagggacatccttcgataagacctcagtcacatgggtgtcactt
gcccgtgtggcagctctgtgcaatagggcagtgtttaaggcagggcaggagtctctccca
atcctgaagagggacgtggctggtgacgcctcagagtcagccctgctgaaatgtattgag
ctctcctgtggctcagtaaaagctatgagggacaagaacaaaaaggtggctgagattccc
ttcaactccaccaacaagtaccagctttcagtgcatgagacagaagactccaaaaacacc
ccctacctgctggtgatgaagggggcgccagagcgcatcctggatcgctgctccaccatc
atgctgcagggcaaggagcagcccatggatgaggagatgaaggaggccttccagaatgcc
tacctggagctgggaggactgggagagcgagtgctgggcttctgccatttgtttttgcct
gaagacaagtaccccaaaggctttgccttcgataccgatgatgtcaacttccagacagac
aacctgtgctttgtgggcctgatgtccatgatcgacccgccccgcgctgctgtgcccgat
gcagtgggcaagtgccgctcggccggcatcaaggtcatcatggtgacaggggaccaccca
atcacagccaaggccattgctaaaggggtgggcatcatctcagaaggcaacgagacggtg
gaagatattgctgcccgtcttaatatccctgttagccaggtcaatcccagggatgccaaa
gcatgtgtgatccatggctcggacctgaaggatctgacccaggagcagatggacgaagtg
ctgaagaatcacaccgagattgtctttgccaggacctcgccacagcaaaagctcatcatt
gtagagggctgccagagacagggtgccatcgttgctgtgactggggacggtgtgaatgac
tcaccggctctgaagaaggctgacatcggggtggccatgggaatctctggctctgacgtg
tccaaacaggctgctgacatgatcctgttggatgacaactttgcttccatcgtcacgggt
gtggaagagggacgtctaatctttgataacctgaagaaatctattgcctacaccctgacc
agtaacatccctgagatcacaccctttctgtttttcatcttggttaacattcctcttcct
ctgggcaccatcacgattctctgcattgacctaggcactgacatggtgcctgccatatct
ttggcctatgaagcagcagagagtgatatcatgaagcgtcagccccgtaaccccctgagg
gacaagctggtcaacgagcgtctcatcagcatcgcatatggccagatcggtatgattcag
gcacttggtggcttctttgcctattttgttatcatggctgaaaatggtttcctgccctct
ctacttgtgggcatccgtttgaactgggatgaccgctccaacaacgatctggaggacagc
tatggccagcaatggacctatgagcagaggaagattgtggagttcacctgtcacacagct
ttcttcgtcagcattgtggtggtgcagtgggccgatgtcatcatctgcaagacccgccgc
aactctgtgttccagcaaggcatgaagaacaagatcctgatctttggtctgtttgaggag
acagctctggctgccttcctgtcttactgcccaggaatggacgtggctctcaggatgtac
ccactcaagcccagctggtggttctgcgcattcccatacagtttcctaatctttgtttat
gatgagatccggaaactcatcctacgccgaaacccaggaggttgggttgaaaaggagacc
tactattaa

DBGET integrated database retrieval system