KEGG   Electrophorus electricus (electric eel): 113581676Help
Entry
113581676         CDS       T05787                                 

Definition
(RefSeq) transforming growth factor beta-2 proprotein-like
  KO
K13376  transforming growth factor beta-2
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee04010  MAPK signaling pathway
eee04060  Cytokine-cytokine receptor interaction
eee04068  FoxO signaling pathway
eee04110  Cell cycle
eee04218  Cellular senescence
eee04350  TGF-beta signaling pathway
eee04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:eee00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113581676
   04350 TGF-beta signaling pathway
    113581676
   04068 FoxO signaling pathway
    113581676
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113581676
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    113581676
   04218 Cellular senescence
    113581676
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    113581676
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:eee04052]
    113581676
   00536 Glycosaminoglycan binding proteins [BR:eee00536]
    113581676
Cytokines and growth factors [BR:eee04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   113581676
Glycosaminoglycan binding proteins [BR:eee00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   113581676
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta YscO-like
Motif
Other DBs
NCBI-GeneID: 113581676
NCBI-ProteinID: XP_026872795
Position
Unknown
AA seq 415 aa AA seqDB search
MWFINLILLILKLLVSAEGFSTCQSYDLDDHKSKRIEAVRGQILSKLRLRAPPDPASSPP
PESLPVEVMLLYNSTKELLKERVRQAESSCDRESSEEDYYAKEVQRVDVLPQRADTNAIN
TVPQNPYFRVVRFDLTNVERNSSTLVKAEFRIYRVQNARARVTEQRVEIYQILKSDDVTA
PSQRYIDSRTVQPQAKGAWLSVDVTETLKEWMAFQEKNLGLKLSVHCPCCTFVPSTNNIL
FNKSEELEARFAGVDDDLVRQNRRPGLTKGQVEFSTKTPHLILTLLPTDRLENPNKKHRK
RRAASDTTTCSRNADQSCCLRSLYIDFRRDLNWKWIHEPKGYRANFCAGNCPYLWSADNH
YNMILPLYNKMNPEASASPCCVPQDLEPLTIVYFLGRTPRVEQLSNMVVKSCKCR
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgtggttcatcaatctcatactgcttattctaaaactattggtttcggcagagggattt
tctacttgtcagtcttatgacttggacgaccacaaatcaaagaggatagaggcggtgcga
gggcaaatcctcagcaagctgcgccttcgcgcaccacccgatcctgcctccagtcctcca
ccagagtcgctacccgttgaggtaatgttactgtacaacagcactaaggagcttctgaag
gaacgtgtgcgccaggccgagtcttcttgcgaccgggagagtagcgaggaggattattac
gcaaaggaggtccagcgtgtggatgtgcttcctcagcgcgcggacactaacgcgataaac
acagtgccccagaatccatacttcagagtggtgaggttcgacctaaccaatgtagaaaga
aattcaagcacacttgtcaaggcggaatttcgcatctacagagtgcaaaacgcacgagcg
cgcgtcacagaacaacgagtggaaatataccagattttgaaatctgatgatgttacggct
ccttctcagaggtacatcgattcaagaacagtacagccccaagccaaaggggcatggctg
tctgttgatgttacagagacattgaaggagtggatggcttttcaagagaagaatctggga
ctgaagctcagcgttcattgtccatgctgcacattcgttccatctacaaataatatcctg
ttcaacaaaagtgaggagctggaagctcgatttgcaggtgttgatgatgacctggttcgc
cagaacaggcggccaggtctgacaaaaggccaggtggagtttagtactaaaacgccgcac
ctcatactaacgctgctacccactgaccgtttggagaaccctaacaaaaagcaccgcaag
aggagagcagccagtgacactacaacatgctcaaggaatgcagaccaaagctgctgtttg
aggtctctatatattgacttccgtcgggatctaaattggaaatggatccatgagccgaaa
ggataccgagcaaatttctgcgcagggaactgtccctacttgtggagcgcagataatcac
tacaatatgattctgccactctataacaaaatgaatcctgaggcctcagcatcaccctgc
tgtgtgccccaggacctggagcccctcactattgtttatttcctgggtcggacaccccga
gtggagcagctttccaacatggtcgtcaaatcttgtaaatgccgctga

DBGET integrated database retrieval system