KEGG   Electrophorus electricus (electric eel): 113582233Help
Entry
113582233         CDS       T05787                                 

Gene name
gatb
Definition
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee00970  Aminoacyl-tRNA biosynthesis
eee01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eee00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    113582233 (gatb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:eee03029]
    113582233 (gatb)
Enzymes [BR:eee01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     113582233 (gatb)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     113582233 (gatb)
Mitochondrial biogenesis [BR:eee03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    113582233 (gatb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-GeneID: 113582233
NCBI-ProteinID: XP_026873693
Position
Unknown
AA seq 552 aa AA seqDB search
MAASSSGNRILLHKLNELITFKRICNITQHDIFIRRIRTSRSKCQLQPKMHTKSPPQMVG
VVGLEIHAQIHAASKLFSSSGVRFSAPPNSLVACFDASLPGTLPVLNRRCVEASVMTGLA
LNCTINRKSLFDRKHYFYADMPAGYQITQQRLPIAVNGSLTYSYLGGRKRNQVVTKNVRI
KQIQLEQDSGKSLHDDHRNQTLIDLNRAGVGLMEVVMEADMECGEEAAAAVRELQLILQT
LGTCYGNMAEGQLRVDANVSVHRPGEPLGVRTEVKNINSARYVAKAIDYEIQRQMEVLDT
GGTILNETRAFDSKSGATVPMRDKEGLQDYRFMPEPNLPPLFVYESVASVPAGVDPTQVV
VIDRLKAILPELPGVKRAQLVEEYGLLPEHSFTLVNEVGLMDYFERVIQKTKAEPRKVIG
WVIKELLGNLNQNGLRLTQSPISSEALAELLNILESGHISTSAAKVVFQEMWKFPEKSVK
QLVAELDLELISDQEQILQICRRVVDAHPEEVRVIRAGNKKVLNKLMGIVQKETKGRTDP
LQVRRILEEMTS
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggctgcctcctcttcgggcaaccgtattctgttgcacaaattaaatgaacttattaca
ttcaaacgtatttgtaacattactcaacatgatatctttattagacgtatacggacatct
agatccaaatgccaactccagccgaaaatgcatactaagagcccccctcagatggtcggg
gtcgttggcttggagatccacgcgcagattcacgcggcgtcaaagctgttctcgagctcc
ggggtcaggttctctgctccgccaaactctctggtggcgtgtttcgacgcatcattgcct
gggacactaccagtgctaaacaggagatgtgtagaggcctcggtaatgacaggccttgcc
ctgaactgtaccatcaacaggaagtccctttttgacaggaagcactacttttatgctgac
atgcctgcaggctaccagatcacacagcagagactgcccattgcagtgaatggatccctc
acttatagctacttaggtggaaggaagaggaaccaggtggtgacgaagaatgtgaggatt
aaacagatccagctagaacaggacagtggcaagagtctccatgacgaccaccgcaaccag
acactcatagatctgaacagagcaggtgtgggtctgatggaggtagtgatggaggcagat
atggagtgcggggaggaagcagccgcagctgtgcgagagctccagctcattctgcagacg
ctgggcacctgctacggaaacatggccgagggtcagttgagagttgatgctaatgtttcg
gtccaccgtcctggggaaccgctgggtgtacggactgaagttaagaacatcaacagtgct
cgatatgttgccaaggcgatagactatgagatccagaggcagatggaggttctagacact
gggggaaccatccttaatgagacccgggcctttgacagcaagtctggagcaacagttcca
atgagagacaaggagggacttcaggactacaggttcatgccggagcccaatcttcctcct
ctgtttgtttatgagagcgtggcctcagtgcctgctggcgtggaccccacccaggtcgtg
gtgattgacaggctaaaggccatcttgccagagctccccggagtaaaaagggcacagctc
gtggaagagtacggcctcctgcctgaacatagcttcactttagtgaatgaggttgggttg
atggactactttgagcgagtcatccagaaaacgaaggcggagccgaggaaggtaattggc
tgggttattaaggagctgctgggtaatctgaaccagaatggcctgaggcttacacagagt
cccatctcttcggaagctctggccgaactgctgaacattctagaatctggtcacatctcc
acctcagccgccaaagtggttttccaggagatgtggaagtttcctgagaagagtgtgaag
cagctggtggcagagctggacctggagctcattagtgaccaagagcagatcctgcagatc
tgtcgcagagtggtggacgctcaccctgaggaggtgcgggtgatccgggcaggtaacaag
aaggttctgaacaagctgatgggcatcgtacagaaggagacgaagggccggacagatccg
ctccaggtcaggagaatccttgaggaaatgacatcatga

DBGET integrated database retrieval system