KEGG   Electrophorus electricus (electric eel): 113582625Help
Entry
113582625         CDS       T05787                                 

Definition
(RefSeq) sodium/potassium-transporting ATPase subunit alpha-1-like
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee04260  Cardiac muscle contraction
eee04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:eee00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    113582625
   04261 Adrenergic signaling in cardiomyocytes
    113582625
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eee04147]
    113582625
Enzymes [BR:eee01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     113582625
Exosome [BR:eee04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   113582625
  Exosomal proteins of other body fluids (saliva and urine)
   113582625
  Exosomal proteins of colorectal cancer cells
   113582625
  Exosomal proteins of bladder cancer cells
   113582625
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1-E2_ATPase Cation_ATPase Cation_ATPase_N Hydrolase
Motif
Other DBs
NCBI-GeneID: 113582625
NCBI-ProteinID: XP_026874293
Position
Unknown
AA seq 581 aa AA seqDB search
MGQEREKNKYKATNNNGKNEENVSDLKKELDLDDHKLTLDELQQKYSTDLNRGLSSSHAK
EILARDGPNALTPPPTTPEWVKFCKQLFGGFCTLLWIGAFLCFVAFIVQLTTESEPTNDN
LYLGAALASVVIITGCFSYYQEAKSSKIMESFKNLVPQHALVVRDGEKKHIKVEEVVTGD
VVEIKGGDRIPADLRIISSHGCKVDNSSLTGESEPQPRSSEFSHENPLETKNIVFFSTNC
VEGSATGVVISTGDRTVMGRIATLASSLEVGKTPIAIEIEHFIHIITTVAIFLGVTFCTL
SLILGYGWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMAKKNCLVKNLEAVETLGS
TSTICSDKTGTLTQNRMTVAHMWFDNQIHEMDTTENQSGTSFDRSSPTWSALARVAGLCN
RAEFLANQSNVPILKRKTAGDASETAFLKCIELCSGSVKDMRYKYPKMAEIPFNSTNKYQ
LSIHKNPNPAETKHVLLMKGAPEKILDRCSTIMLQGKEQPLDDEIKDTFQNAYMTLGGLG
ERVIGVLYYQVAYTLLLLDIPFFLTFPILRHITLLIFIFFF
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgggacaggaaagagaaaagaacaagtacaaggccacaaacaataatgggaagaatgag
gagaatgtcagtgacctaaagaaagagctggatctggatgatcacaagctaaccttggat
gaactccagcaaaaatacagtacagatcttaacaggggtttgtccagttcccatgcaaag
gagatcctggcccgtgatgggcccaatgcattgaccccccctcctacaactcctgaatgg
gtgaagttctgtaaacagctctttgggggattctgcactctgctgtggattggtgctttt
ctctgttttgtggctttcatagtacagcttaccacagagagtgagccaacaaatgataat
ctgtacctgggtgctgctcttgcttctgtggtaataatcactgggtgcttctcatactat
caggaggctaaaagttcaaagatcatggaatccttcaagaatctcgttccacagcatgct
ttagtggttcgggatggtgaaaagaagcacattaaagtcgaagaagtggttactggtgat
gttgtggagattaagggtggtgaccgcatccctgctgatctacgcatcatttcttcacat
ggatgcaaggtggacaactcttcccttacaggagaatctgagccccaacctcgttcttct
gaattctcccatgagaatccacttgagacaaaaaatattgtgttcttttcaacaaactgt
gtggaaggttctgcaacaggtgttgttatcagcactggtgatcgcactgtgatgggccga
attgctactcttgcctcaagcctagaagttgggaagaccccaattgccatagagatagaa
cactttatccacattatcaccactgtggctatttttctgggtgtgaccttctgcaccctg
tccctcatccttggatatggctggctggaagctgtaattttccttattggaatcattgtt
gccaacgtgcctgagggtctgcttgctactgtcactgtatgtttaacgctgactgccaaa
cgtatggccaagaagaactgcctagtgaagaatcttgaagctgtggaaactcttggctcc
acctccaccatctgctcagacaagacaggaacccttactcagaaccgaatgactgtggct
cacatgtggtttgacaaccagatccatgaaatggacactacagagaaccagagtggaacc
tcttttgacagaagctctcctacatggtcagccctggctcgtgtagctggcctgtgcaac
cgtgctgaatttcttgctaatcaaagcaatgttcccattcttaagagaaaaactgcaggt
gatgcttcagagacagctttcctgaagtgtattgagctctgctctggttcagtgaaggac
atgagatacaagtacccaaagatggctgagatccccttcaactccacaaacaaataccag
ctctcaatccacaagaacccaaatcctgcagaaaccaagcatgtgctattaatgaaagga
gcacctgagaagattctggaccgatgttcaactatcatgcttcagggaaaagagcagccc
ttggatgatgaaataaaggatactttccagaatgcatatatgactctaggcggtcttgga
gaaagagtcataggtgtgctttattatcaagtagcatacaccctcctattgctagacatt
cccttttttctgacattccctattctcaggcacattacattgctgatctttatctttttc
ttttaa

DBGET integrated database retrieval system