KEGG   Electrophorus electricus (electric eel): 113582672
Entry
113582672         CDS       T05787                                 

Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee04080  Neuroactive ligand-receptor interaction
eee04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:eee00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    113582672
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    113582672
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 113582672
NCBI-ProteinID: XP_026874384
Position
Unknown
AA seq 77 aa
MNVKILTLAVVLLLSLLCSARAAPVASTEHSKELEEVNSMRAPARQSPARAGRNQRPAGW
RRRRPRPRLSHKGPMPF
NT seq 234 nt   +upstreamnt  +downstreamnt
atgaatgtgaagattctgacgttggcggtcgtgctgctgctgtctctgctgtgttcagct
cgtgctgctcctgtggcatccacagagcacagcaaggaactggaggaggtgaacagcatg
cgggcccctgcacggcagagccctgcccgagccggccggaaccaaagacccgccggctgg
aggaggagacgcccacgaccccgtctgtcccacaaggggcccatgccgttctag

DBGET integrated database retrieval system