KEGG   Electrophorus electricus (electric eel): 113583760Help
Entry
113583760         CDS       T05787                                 

Definition
(RefSeq) ankyrin repeat and SOCS box protein 13-like
  KO
K10335  ankyrin repeat and SOCS box protein 13
Organism
eee  Electrophorus electricus (electric eel)
Brite
KEGG Orthology (KO) [BR:eee00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:eee04121]
    113583760
Ubiquitin system [BR:eee04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     113583760
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_3 Ank_4 Ank_5 Ank SOCS_box UPF0051
Motif
Other DBs
NCBI-GeneID: 113583760
NCBI-ProteinID: XP_026876071
Position
Unknown
AA seq 286 aa AA seqDB search
MDIAAARSTTYGDLGFWADRTSVHEAASLGRSLQLKQLIEGGASVNIVTVDNITPLHDAC
MQGHPQCVRMLLDAGAQVDVRTIHGSTPLCHACASGSVESVRLLLDHGATVNPSLTALTA
SPLHEACIRGNPECVKLMISKGALLEAFDIHFGTPLHAACAKAHLDCALLLLNAGARVNA
IKFHETALHHAARVGRTELIELLVEFGGDINVSDNLGRRPIDYTTPGSSAHLCLQYFENT
PLSLQQLSRIALRTVLGTRALQVVTKLDISRRIIDYLLYVIQSLSG
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggatatagctgctgcccgatcgacgacttacggagatctcggtttttgggccgaccgg
acgtcggtgcacgaggccgcgtctttagggcgatccctgcagctcaagcagctgatcgaa
gggggcgcgtccgtaaatatagtaactgtggacaacatcaccccgcttcacgacgcctgt
atgcagggtcatccgcagtgtgttcgcatgcttcttgacgccggcgctcaggtggatgta
cggaccattcatggaagtacccctctctgccatgcttgtgcgtcagggagtgtggagagc
gtaagactactcctggaccacggagcgacagtaaatccctccctcaccgccctcaccgcc
tccccactccatgaggcctgcatacgcggtaacccagaatgtgtgaagttgatgatatca
aagggagcactgctggaggccttcgatattcactttgggacgccgttgcacgctgcctgc
gctaaagcacatctggattgcgctctgctgctgctgaacgcaggtgccagggtgaatgcc
ataaagttccatgagaccgctctccaccatgccgcgagagtggggcggacagagctgatc
gagcttctggtggagtttgggggagatattaatgtttcagataaccttggacgcagaccc
atagattacaccaccccagggtcctcggctcacctctgcctgcagtactttgagaatact
ccgctgtctctgcagcagctgagccgtatagcactcaggactgtactcggcaccagagca
ctgcaggttgtgaccaaactggacatctcacgacgcataatcgattacctgttatacgtg
atacagtccctttctggataa

DBGET integrated database retrieval system