KEGG   Electrophorus electricus (electric eel): 113583932
Entry
113583932         CDS       T05787                                 

Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1-like
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
eee  Electrophorus electricus (electric eel)
Brite
KEGG Orthology (KO) [BR:eee00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:eee01002]
    113583932
Enzymes [BR:eee01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     113583932
Peptidases and inhibitors [BR:eee01002]
 Metallo peptidases
  Family M1
   113583932
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N RE_HpaII
Other DBs
NCBI-GeneID: 113583932
NCBI-ProteinID: XP_026876373
Position
Unknown
AA seq 927 aa
MLKLSIILFLSLTPTHARDGGNIVFGSFGTTGPSFEWKMRLTDSVKPLLYDLLIHPNLTS
LNFTGTVQIHLEVQRETKHIFLHSKNLHISKAFILGSRHPHHLVVRESELYEQIALFCEG
FTFTRGNHIIQLHFSANLSDSFHGFYKGSYTTRSGEVRSLASTQFEPTHARAAFPCFDEP
SFKANFSIRIRREPRHISISNMPKLKTVELADGVLEDKYDVSVKMSTYLVAFIVCDFLSI
SKRSQHGVEISVYTVPEKISQAEYALNTAVTLLDFYDDYFEIPYPLPKQDLAAIPDFQSG
AMENWGLTTYRESGLLFDPERSSTSDKLGITKVIGHELAHQWFGNLVTMHWWNDLWLNEG
FAKFMEFLSIDITYPELQVNDYFLEKCFTAMGVDSLRSSHPISTPVENPAEIREMFDDVS
YQKGACVLNMLRDFLTPEVFKMGIIRYLKKHSYQNTVNAHLWYSLTNVCQSGDLDAGRLK
AAGFCSDRKSRTSASKWYMEDDLNVKALMDTWTLQEGFPMITVEVKGREVRLKQERYLKG
ADPSKNSSFLWQVPLTYITSSSRSVQRFLLKTRKDVLYLPMEVEWIKFNVDMRGYYMVHY
EDGGWDPLIRQLQHNHTVFSGNDRASLIHNIFQLVSIGKVPLDKALSLSVYLKHEVEVMP
VTQAFSELVPLYKLMEKRDMAVLEHKLKGFLVHLFQGLIDAQQWSDEGSVAERVLRNYLL
LFACVRRYAPCVRTAQELFHKWKDADGEMRLPADVRLVVYTEGARTEEGWDFLLEKYLHT
MYPSEKAQIKAALSYSPLAHKLHWLLERALKGDMLKTHELPSLLISVSKNPKSYKMAWDF
LKSNWQELVKKFDLGTSSISRMVVGVTNQYSTKEMLNEVRLFFSSLRDDMGARLRSVQQA
LENIEENIRWMEKNTPLLTEWLNIHSV
NT seq 2784 nt   +upstreamnt  +downstreamnt
atgttgaaattgagcattatacttttcctttccctcacccctactcatgccagagatggt
ggaaatattgtatttggcagtttcggtacaactggtccatcgttcgaatggaagatgaga
ttaacggattctgttaaaccacttctctacgatctcttaatccacccaaatctgacttca
ctgaacttcacgggaactgtacaaattcatttagaggtgcagcgggaaaccaaacacatc
tttcttcacagcaagaaccttcatatctcaaaagcattcattctaggatccagacatcct
catcaccttgtcgtccgcgagtctgaactatacgagcagatcgcactgttctgcgaaggc
ttcacgtttactcggggaaaccatataatacagctgcatttctctgctaacctgtctgac
agttttcacggcttttataaaggctcatacaccacgcgcagtggtgaagtccggtcgttg
gcatccacccagtttgagcccacacatgcccgagctgcattcccatgtttcgatgaacca
tccttcaaagccaacttttctatccgtatacgtcgagagccgaggcatatttccatttcc
aatatgcctaagttgaaaaccgtggagcttgcagatggtgtattggaggacaagtatgat
gtcagtgtgaagatgagcacctatctagtggcctttatcgtctgtgattttctctccatc
agtaagaggagccagcatggagtggagatatcggtgtacaccgttccagagaaaatcagt
caggcagaatacgccctaaacacagcagtgacgctgctcgacttttatgatgattatttt
gaaatcccatatccacttcccaaacaagatcttgcagcaatcccagacttccagtcaggt
gctatggagaactggggcttgactacatacagagagtcagggctcctctttgaccctgaa
cggtcatctacctcagacaaactgggcatcaccaaggtcattggccatgagcttgcccat
cagtggtttggaaacctggtgacaatgcattggtggaatgacctctggttaaatgagggt
tttgccaagttcatggagtttctgtccatcgacatcacctaccctgagctgcaagtgaat
gattacttcctggagaagtgttttactgcaatgggggtagactctttaagatcctcccac
cccatctctactcctgtggagaatcctgcagagataagggagatgtttgatgatgtatct
tatcagaagggagcctgtgttttgaacatgctacgagatttcctgaccccagaagtcttt
aaaatgggtattatacgttacctgaaaaagcacagctaccagaacactgtgaatgcccac
ctttggtacagtctgacaaacgtatgtcaatcaggtgacttggatgcaggaagactgaaa
gcagctggtttctgctctgacaggaagtctagaacttctgcctccaaatggtatatggag
gatgacctgaacgtgaaggctctcatggatacctggacactgcaagaggggtttcccatg
atcactgtggaggttaaaggtcgagaggtcagactgaaacaggagcggtaccttaaaggg
gcagatccttcaaagaattcgagtttcctgtggcaagtgcccttgacctacattaccagc
agttccaggtctgttcagcgttttcttctaaaaactagaaaagatgtgttatatttgccc
atggaagtggagtggatcaagttcaacgtggacatgcgagggtattacatggtccattac
gaggatggaggttgggaccctctgatcaggcagctccagcacaatcacacggtgttcagt
gggaacgaccgagccagcctgatccacaacatcttccagctggtcagcatcgggaaagtg
cctctggacaaggctctgagcctgagtgtgtacctgaagcatgaagtggaggtgatgcct
gtcacacaggccttcagtgagctggtgcctctctacaaactcatggagaagcgagatatg
gcagttctggagcacaagctgaagggctttttagttcacctcttccagggcctgatcgac
gcgcagcagtggagcgacgagggctcagtggcagaacgtgtgttgcgcaattacctgctt
ctttttgcctgcgtacgccgttacgcaccctgcgtccgtacagcccaggagctcttccac
aagtggaaagacgcagatggcgagatgaggttgcctgctgatgtccggttagtggtgtac
acggaaggcgcaaggacagaagaaggctgggacttccttctggaaaaatacctccacacc
atgtacccatctgagaaggctcagatcaaagctgcgttgtcctacagtccgctggctcac
aagctgcattggcttctggagagggctttgaaaggagacatgcttaagacccatgaactg
ccatctctacttattagtgtcagtaaaaaccccaaatcctacaaaatggcctgggacttc
ctaaagtccaattggcaagaactggttaagaagtttgatcttggcacctcctctatctca
cgcatggttgttggagtgaccaatcaatactcaaccaaggaaatgttaaacgaggtgcga
ttgttcttcagttccctgcgagatgacatgggagccagactgcgcagtgttcagcaggcc
ttggagaacattgaggagaatatacggtggatggagaagaacactccccttctcacagag
tggctcaacatccacagtgtctga

DBGET integrated database retrieval system