KEGG   Electrophorus electricus (electric eel): 113584338
Entry
113584338         CDS       T05787                                 

Definition
(RefSeq) aryl hydrocarbon receptor repressor-like
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
eee  Electrophorus electricus (electric eel)
Brite
KEGG Orthology (KO) [BR:eee00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:eee03000]
    113584338
Transcription factors [BR:eee03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    113584338
SSDB
Motif
Pfam: PAS HLH PAS_9 PAS_4 PAS_3
Other DBs
NCBI-GeneID: 113584338
NCBI-ProteinID: XP_026876965
Position
Unknown
AA seq 617 aa
MIPPGDCLYAGRKRRKPIQKQKPATAANQKPNPSKRHRDRLNAELDRLAGLLPFTPDVIS
KLDKLSVLRLSVSYLRVKSFFHAIQEKPCRKNSIEASSPELRKPSLGSSVLESDLLLESL
TGFALVVSSDGVIFYASSTIADYLGFHQTDVMHQNVFDYIHVEERQEFRRQLHWAMNPSS
QEDHAGEDFVARGLRSTPEAGSVPPELAPFLTRCFVVRVRCLLDTTSGFLNMQFQGSLKV
LQGQMKKVERGTLLPPRLALFCVATPLVLPSIELKMKNTVMKSKLKGPSSSEKRLHGSRG
SCDVGGMQLPSTPFRDHCHGGLWSALAKEGTQFRSNNFYTRDEPLNFCLSSTELPKAQAA
DSPWDMRSLSRTAPASPSPGKFNKHTQPGTFRILPGCSAAPSQGRHHGQSTREAYSGKAE
SRYTAHSENNHGLLLPETAIKTEQDSDSESSCSAYTAPHNGGWRYSSTFPEGRQLKMEED
HYSHYGPCQCSKAGVSPPVNGHHKYLCTGASKPAMCVLNKDIAHPDPPGNQGPGCLDNHE
YADGSAEPKVFMQLDYMLSYEFRRHGLLHSIKREPADSPPPWQDSSRNLSRARAERNTYN
CTMNAAANKASSYLYMQ
NT seq 1854 nt   +upstreamnt  +downstreamnt
atgattccacctggggattgcctgtatgctggacggaaacggagaaagcccattcaaaaa
caaaaacctgccacagcagcgaaccagaagcccaacccgtctaagagacaccgcgaccgg
ctgaacgcggagctggaccgcctggccggactgctgcccttcacgccagatgtcatctcc
aaactggacaagctgtctgtgctgcggctgagtgtgagctacctccgcgtaaagagcttc
tttcatgctattcaggagaaaccgtgcagaaagaacagcattgaggcctccagcccggag
ttaagaaaacccagcctgggaagcagcgttctagagagtgatcttctgctcgagtcttta
acagggtttgctctggttgtgagctcagatggagtgatattttatgcctcttccaccatc
gctgactacctgggcttccatcagacggatgtgatgcaccagaacgtctttgattacatc
catgtggaagagaggcaggaatttagaagacagctccactgggctatgaaccccagctca
caggaggaccatgctggcgaggacttcgtggcgagaggtctgaggagcactccggaggcg
ggcagcgtccctcctgaactcgcgccgttcctcacgcgctgtttcgtcgttcgagtgcgc
tgcctgctcgacaccacctccggctttctgaacatgcagttccagggtagtctgaaggtc
ctacagggtcagatgaagaaagtagagcgcgggactctgctgccccctcggctggcgctg
ttctgcgtggccacgcccctcgtgctgccttccatcgagctcaagatgaagaacacggtg
atgaagagcaagcttaaaggccccagcagcagtgaaaagaggcttcatggttcccgtggc
tcctgtgatgtggggggcatgcagctgcccagcacgcccttcagagaccactgccatggg
ggtttgtggtcagccctcgccaaagagggcacccaattcaggagcaacaacttctacacc
cgggacgagcccctcaacttctgcctgtcctccacggagctccccaaagcccaggccgcg
gacagtccctgggacatgcgctcgctctcacgcactgcgcccgccagcccctcccccggc
aagttcaacaagcacacccaacccggaacgttccgcattttgccgggttgctctgctgcg
ccatcgcagggcaggcaccatgggcagagcacgagggaggcttacagtgggaaggcggag
agcaggtacacggcacacagtgagaataatcatggcttgcttctgcccgagactgccatt
aagacggagcaggactccgactcggagagcagctgcagcgcctacaccgcgccccataac
ggagggtggcgctacagctccacctttcccgagggacggcagttgaagatggaggaagac
cactacagtcactacggcccgtgccagtgcagcaaggctggtgttagccctcctgtcaac
gggcaccacaagtatctctgcacgggggccagcaaacccgccatgtgcgtcctcaacaaa
gacattgcgcatcctgatcctcctggcaaccagggcccaggctgtctcgacaaccatgag
tatgcagacggctcagccgaacccaaggtcttcatgcagctagactacatgctgagctat
gagttcaggagacacggccttctccactccatcaagagagagccagcagactcccccccg
ccctggcaggacagcagccgtaacctcagtcgagcacgcgcagaaaggaacacatacaac
tgtacaatgaacgcagcagcgaacaaagccagttcctatttgtacatgcaataa

DBGET integrated database retrieval system