KEGG   Electrophorus electricus (electric eel): 113584737Help
Entry
113584737         CDS       T05787                                 

Gene name
suclg1
Definition
(RefSeq) succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee00020  Citrate cycle (TCA cycle)
eee00640  Propanoate metabolism
eee01100  Metabolic pathways
eee01200  Carbon metabolism
Module
eee_M00009  Citrate cycle (TCA cycle, Krebs cycle)
eee_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:eee00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    113584737 (suclg1)
   00640 Propanoate metabolism
    113584737 (suclg1)
Enzymes [BR:eee01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     113584737 (suclg1)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     113584737 (suclg1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 113584737
NCBI-ProteinID: XP_026877645
Position
Unknown
AA seq 324 aa AA seqDB search
MAHPRLFTRLLLQQTGVRHCYNGTRKNLYINKDTKVICQGFTGKQGTFHSQQSLDYGSRL
VGGVSPGKGGKTHLGLPVFNSVKEAKEGTGADATVIYVPPPFAAAAIMEAVDAEMPLVVC
ITEGIPQQDMVRVKHRLLRQNITRLIGPNCPGVINPGECKIGIMPGHIHKKGRIGIVSRS
GTLTYEAVHQTTQVGLGQSLCVGIGGDPFNGTNFIDCLAVFLQDPETEGIILIGEIGGSA
EENAAQYLKEHNCGAKAKPVVSFIAGLTAPPGRRMGHAGAIIAGGKGGAKEKIAALQSAG
VIVSMSPAQLGSTIFKEFEKRKLL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggctcaccctagactgtttacccggctgctcttgcagcagactggggtcaggcactgt
tataatggaacgagaaagaacctgtacattaacaaggatacaaaggtcatttgccaaggc
ttcacaggaaaacagggcaccttccacagtcagcaatctctggactatggctctaggtta
gttggaggagtgtcccctggaaaagggggtaaaacacacctgggtttgcctgtcttcaac
tcagtcaaggaggccaaagagggcacaggagcggacgccacggtgatctacgtgccacct
cctttcgcggcggccgccatcatggaggccgtcgacgcggagatgcccctggtggtatgc
atcacggagggcatcccccagcaggacatggtgcgcgtcaagcaccggttgctccgccag
aacatcacccgcctcattgggcccaactgccccggcgtcataaacccaggagagtgcaaa
attgggatcatgcccggacacattcacaagaaagggagaatcggcattgtctcaagatct
ggaaccctaacatatgaagccgtacaccagactacacaagttggcttgggccagtccctc
tgtgtcggcatcggtggagatccgttcaacggaaccaacttcatcgactgcctggcagtg
ttcctgcaggaccctgaaacggagggcatcattttgattggagagatcggaggcagcgcc
gaagagaatgcagcccagtacttaaaggagcacaactgtggtgccaaagcgaagcccgtg
gtgtcgttcatcgctggtctcacagcaccccctggcaggaggatgggtcacgccggtgcc
atcatcgctgggggcaagggcggagccaaagagaaaatcgctgccctgcagtcagcgggt
gtgatcgtcagcatgtctcccgcacagctgggaagcaccatattcaaggagttcgagaag
aggaagctgttgtag

DBGET integrated database retrieval system