KEGG   Electrophorus electricus (electric eel): 113584822Help
Entry
113584822         CDS       T05787                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: titin-like
  KO
K12567  titin [EC:2.7.11.1]
Organism
eee  Electrophorus electricus (electric eel)
Brite
KEGG Orthology (KO) [BR:eee00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:eee01001]
    113584822
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:eee04131]
    113584822
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:eee04812]
    113584822
   04147 Exosome [BR:eee04147]
    113584822
Enzymes [BR:eee01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     113584822
Protein kinases [BR:eee01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   113584822
Membrane trafficking [BR:eee04131]
 Others
  Actin-binding proteins
   Others
    113584822
Cytoskeleton proteins [BR:eee04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     113584822
Exosome [BR:eee04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   113584822
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set fn3 Ig_3 Ig_2 ig V-set Pur_ac_phosph_N fn3_2 C2-set_2 Receptor_2B4 Pkinase C1-set Pkinase_Tyr Ig_5 Titin_Z Izumo-Ig THB Adeno_E3_CR1
Motif
Other DBs
NCBI-GeneID: 113584822
NCBI-ProteinID: XP_026877801
Position
Unknown
AA seq 31457 aa AA seqDB search
MTTQAPTFTQPLQSVVALEGSAATFEAQVSGNPVPEVSWFCDGQVLTAAALPGAQISFSE
GRAVLRIPAVTVAHSGRFSVRATNGAGQATSTAELLVTAETAPPNFIQRLQSMTVRQGSR
VRLDVRVTGIPTPVVKFYREGAEIQSSADFQIVQDGDLYSLLIAEAFPEDSGTYSVNATN
SSGRATSTAELLVQGEEEAVPAKKTKTVISTSQISKTRQTRVEKKMETHFESTALQMQVE
GGIVTQQLAHKTPPRVPPKPTSKSPPSHLTKVSATRHQSPSPVRHVKAPTPTPVRAVSPS
TRLSVSPIRPVKSPVLTRRQVTPGAEVLPPWKQAGYVSESSYQASLKAKVTEMHWETAVT
EQKQPVPKEVWALLWIGNVAFLRCEINCFVRMEQQSMDDKSGAVATVVAAVDQARSRHPP
SGSTEPHSVESSTATLLAPTIDQQMKPMVDVSPMAVHEQANIREITGARSECIMETMETS
SASYTLVSQEKGDGKKAGAVATVLAAVDQARVRKPVHVESTVTQEETAIKQQAVLTAKQQ
VTSRTEEFQISPAMLRDTSEKSVPVIQIPRTTEISPQVDTGLAPSPIPHFTVSKVTVPKP
DHSYEVSIAGSAIATLQKELSSTSGVQKIIKPVKPPTHKAVEMRVTPELTPPPFKDITEK
YQSHFNTELQRQIGASYAGEWEKQVVETAAVPSAVKQPVMPPTVVVGLKNMTVTEGESVT
LECQISGHPTPGIMWFREDYRIESSIDFQITYEKTYARLVIREAFAEDSGRFTCTATSEA
GTISTSCYLLVQVCEEIEGREEITMEKHIETKEEAVSEVSAVSKTIEVGTAVAPFFVRKL
ATQKLVEGGSVVFDCQIGGNPKPHIYWKKNGVPLTTGYRYRVSYNKDTGECKLEISMTFA
DDAGEYTISARNQHGEVSASTSLLEEEEYEAYMKTQEVIYKTEVTTAVVPEPRVADVAPE
MLRRLPQQPQMMQTFISEKEFHISAIEQRIIQEIEVQILKITYRELVIEDGEEMLMNVAE
HEAVGSSFSTPVKSYRIMEGMGVTFHCKMEGTPLPKIAWYKDGKRIKHGGRYQMEVLQDG
RTSLRIPVVLPEDEGVYTALASNMKGNAVCSGKLYVESTASVQPYYPQAEAVRRVQSESP
MSARSISLSPGHSPARSVSRSPGRSPARRLDETDESQLERLYKPVFVMKPSSFRCSEGQT
ARFDLKVVGRPMPDTFWFHNGQQVVNDYTHKIVVKEDGTQSLIVVPAMPQDSGEWTVVAQ
NRAGKTTVSMTLTVEAKENLVRPQFIEKLKNLSVKEGTLVELAVKAIGNPRPDIVWLKNS
DIISPHKYPHIKIEGTKGEAHFKIPQITGSDSAWYTATAINKAGRDTTRCRVNVEVEFAE
PEPERKLIIPKGIYKAKEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPHFKKKLTSVR
LKRFGPVHFECRLTPIGDPNMVVEWLHDGKPLAAANRLRMINEFGYCSLDYEVAYSRDSG
VITCRATNKFGVDQTSATLIVKDEKSLVEESQLPEGRRVPRIDEMERIAHEGALSGVTAE
ELMEKTKPEIVLLPEPISVLEGENAKYRCRVTGYPTPKVNWYLNGQLIRKSKRFRLQYDG
IHYLEITDCKSYDSGEVKVLAENPEGTAEHIVKLEIKQREDFRSMLRRAPEVKVPELPGP
EAGKVSFDVIKVDKPVEPSQAKEVVKLRRAERVIHERSPEETEELRSKFKRRTEEGYYEA
ISSVEFKSRKKDESYEEMLRKRKEELLHWTKEIPESEKKKEEEERKLTIPTIRPEKITLS
PSMEAPKIFERIQSQTVGLGEEVRFRCRVVGKPDPECQWFKNGILLEKSDRIYWYWPEDH
VCELVIRDVATEDSASIMVKAINIAGETSSHAFLLVQAKQVVSFTQQLEDMYAKEKDTIM
TFECETNEPFVKVKWLKNNAEIFSGDKYRMHSDRKVHFLSVLVIDMSDDAEYSCTLVEDD
HIRTSARLHVEGAPLEILKTMDNIEVPETYSGEFECELSREDAEGTWYFENKEITPSLKY
VVSSRRGRHCLCVKDVKKEDQGKYTFKVGDLKTTASLKMKLRPVTLLQGLSDLTICEGDI
AQLEVRFSQENVEGTWMKNGQPISATDRVHIVIDKLVHKLLVENVTKDDAGMYSFVVPAQ
NISTAGKLIVQTIGIITPLKDVSTVEGTKAVLEAKISAADVISVKWYQNEKLLTASDRVQ
MVAKGSKQRLVLNRTYASDEGQYRLVVGRVDSSCRLSVQKVSIVKHMEDCVCTETQNVTF
EVELSHSGIDAFWTFKNQPLKAGPRYKIESKGTKYSLTVINAMKDEEGVYTFAAGEKTSS
AKLIVSGGAINRPLQDVTVAESQTAELECEVANPSAEGKWLKDGHPVSFSDNVRSEEIGA
VRRLVIVITRPQDIGEYTYQVANSKTSANLKVEAVKIKKTLKNQTVTETQEAAFSLELTH
LDVKGAQWIKNGVEILPSDKYEITIDGMVHTLKIKDCNAQDESVYGFKLGKLSANARLNV
ETIKIVKKPKDVTSLLSATASFELSLSHDNIPVKWMFKNQELKQTENIQIFSERKAHKVV
IANVDEDMAGEYTAIVGHLQCSAFLHVESLRVTKTMKNVEVPETHTATFECEVSHFNVPS
TWLKNGVEIEMSEKFRIVVQGKLHQLKIMNTSRDDAAEYTFVCGNDRVSATLTVNPILIT
SMLKDLNAQEKDTITFEVTVNYEGITYKWLKNGVEIRSTDRCQTRSRQLTHTLTIRNVNF
GDSAEYKYVAGSAETSANLFVEARVIEFTKHIKDIKVTEKKKAIFECELSEPNVQVTWMK
DGQEIEITERYKVSTDKYIQRLMIQSVRMSDTGEYSVVAGSSISMAHLTVEGKDVRITEP
AQKEITVLERQRVVLEFEVNEDDIEGRWLRNGVEIQLAIDKRFSYATIRKIHRLTIAETY
RSDAGEYTFIAGKNRSVVTLHVNIPEPPQILRHMLDLSVEAGKPARFSVEVTGIPQPQVS
WYKNSQMLSSGFKCKFLREGNEYTLLLIEVFPEDAAQYTCEAKNDYGQATSSASLNVEVP
EVVSPDTGAPLTPPVIISPIQNTSAKEGASARFQCRVSGEDLTITWYCKDKEIKQSSFFR
MSQFDDNCLLEIARVYAEDEGEYSCVARSSAGMVSCSAVLNLEVKKVHEEIETKIEEEFK
EFSSLTVKTMGEEEETYSSTLQLPEKAKTLELKPEQKRYSSSLEKKKEKPIFLTQLAPSE
VTIGSSARFTVTVSGFPKPKVQWFHNGKVITSSSVYKFVEERDEYSLIITKVKKEYEGEY
SCTASNRFGQTTCTTTLKVQVTDLSPAEKWVEHMFKVPGEPPRFTTQIVPVQCAEGCEAK
FEYKVTGTPCPKIQWFKGSDEILPSPDFCIVTDPDGTGFLIMIDIQQSDRGLYTCRASNP
FGEATCSAELIVFQKSYSVSHQQQLTQQKTYKMSMTEEATESRLYSVSLPGQARVSLQEG
QKMIYTIGTEDRQTVASEQVGSLHEIDVSSATVHKEQVTHQAAVLQSHEMQERVTVASRQ
PQTAVATPLRQLHMAAMTSAVQESQGFTEEHLDRIKSPEVTELKSAKEQTSRLMSAITES
VMPLTIVKTQPLTSQEKEQTKAITEPKYPFSSHQVESTLPIVKEQSKTIPQTEAEKSYQV
KEGMKILYAAVSDEKQQITDVHAKDLSVLDIASQSSVKKESPKPAILSVSETKQMLSKEQ
KFFMHRPDKQTAALAKDTVLRSALVAEDVNEFQAEKTSVIPGLDSMVSVQAQREEEQILN
LQIFADQTSLPSEGRFSSEKPSPEQADSRKSPTLLHTVSTDEQQTITCEGSSQFSTEETS
VFIQPHKEALAPLHLQAVQAESMLSKEGILSIEKTDQQMAVQRQEKARKHAVTTEEKREL
TADYSRGLEVSATGVHSDIKKEPKPQSNLQVITEPMQLPKETPFSSETKQQRALVQKEDR
WNIINAMSISDIQDLEEGHTENLCAPEKYTCLAEMEPKIPLESLHVEEKEISTESSVTLD
AAEQDFAVQIQEGQSIRKSILMDEKLLLRGELSQDITKSQTTTATVSQQQMDVLLLSESR
ESQTLPKELTFVIPAPKAHSLDIKPQLKNMLASAVAQDQPLILADVVKQLDVVEVQEVRV
QRQLRYTMFTYLITTAGAPIEITISFEGEYPQTADLKSELQAALYSIIYREQQVLTSEQP
GAMHIDRPQRLQLSRAAAKEKLSPMVETVQLTENTETFFPPKTQSAALKSEDVTSFQSVK
AQKQTVVQGSKSLVIQETTTKMELKQSVQVERQEIRSVTVKSQDRDIGTADITTDGSFVP
VPVEQSDILIQREDTQEYLTEETIKLQKAKVREEYPVFESSLKDVIIDEHSKVTFSVTTR
HVSKVNWLFNGKPVKSGKEFKCLQDKDTYMLVIDKVIKEKHEGEYTFEAVNEAGKTSTTS
RLTVVSRVPPVFKRKINALEASVGSPVTFECEIEDAPNVTFKWFKYGSEIRHSDKYKIIS
HLTTSSLELLSPTKADSGEYTCTALNQHGRDSCSANLNVTEVFPPEFVSKPDPITSFVAK
QAKFHCVITGSAPVNVVWHKDNIAISHNEHYKVFVEKNKYCLEITNLEQSDQGTYLCKAS
NSVGTATCCTELRVIDKPSFVKTFEPTFVAVDNSLRLECQVNEDTGVFITWMRDGKRLHN
TMDSKISFEDRVACLEIPKAKLKDTGTYVCTAANDAGSSIHSSVINVQEPPKFVKRLESK
VLWKQGTSARLLCTVKGSPELHVSWFLNDKQLSSSERHKITFKDGQAALEIIGPTVSDSG
NYTCEVMNEAGCESCSTQLTVKEPPAFKKELETVEVVKGLTAHLECEVTGTAPFEVTWLK
NKKTVNTDKKHKIVSKDTILYLEIQSFDSTDVGDYQCCISNDVGKVTSKSVAKLKDPPSF
VKRVESTTAILGSAVKLQGTLKGSTPITVKWLRDSEILRDDDPNITMIFESNIAVLAIKE
VTIKHGGKYTCQAENEAGQQKSEATLSVQEPARIVDKAPSISVTAGDSATLDCTVSGSPD
LKVKWLRDGKEMTASRKYKISFKDNVASLKFLSAERGDSCEYTLEVSNRVGKDHCSCSVT
VLDKIIPPTFTKILKKVDGNVGGSVQMECKVSGSQPMTISWFKEEKEITTGMKYQTEFRE
STATLKISNLETADTGVFTCHATNAAGHRETSGTVSVKEPPVFTLKPESQEVIPGSTVVL
KATFTGTAPFTIKWFREENEMLTGGTCFIKKEAFSSTLELHSVKPSHSSTYTCQVANDAG
KVSCTAVLFVKEPPRFVMKLDPAKLAMNGTAVFLECKVTGSPEITMKWYKNEMEITQSAK
YQMTFSDSVATLQVPNCSVEDSGDYICVASSDAGSDRCSCLVTVKEPPVFVKLFESKEVV
KGSDVVLEGSISGSPPFEVSCIKNSKQIRNDRRHVISMKNDVVSLQILKFEVGDAGKYQC
TVGNEVGQTSCDCEIVLKEPPSFVQKLDTMNILLGSELTMQCVLKGSLPMTVLWTKDDHE
VKDTEHVQMSFENRTALLHVSSVQSKHGGKYTCHAQNEAGSQKCTAALVVKEPANITEQA
KSISVTVGDPATLECRFSGTKALKSKWMKDGKELTSGKKYKVHSTDKNCTLKILSAERCD
EGEYMFEVSNDVGKSTCEAFVTVLDQIIKPSFTRKLKEMEIIKGSFTQLECLVSGSLPIM
ITWFKENKEIETDEKHKCIFFENAASLEINRLDSSDSGNYTCIATNKAGRDQCSGVLKVK
EPPSIIEKPESQEVIPGTRVKFNVLVMGTPPLNIKWFKDKKEILSGIDCSVQKDDSSSFL
ELFFTKPSDSGDYICEVTNDVGSDTCQATLFVKEPPKFTQKPDKVSVVKPGHLVVFECQV
AGTPEIDTYWFKDGTEISPSDKYKMSFVNSLACLEITGSDVKDSGVYYCEARNDAGSESC
SMELKVKEPPVIVKPFTPAEVVKGSNAYFECQIKGSAPFEITWQKDSKEIKASTKHLFYQ
KNASIIVLDIHKCDDLDVGEYQCIVSNEVGSCSCRTTLHIKEPPSFVEKIQNVATVLGDV
AEFKCIVRGSPPLIIQWQKDETWILEDSKIMRTFDDNVATLKIPVCDPSHSGRYTCQAMN
EAGQEKCFATLLVQEPPQIIEKPEIINVTAGDPVSFECKVKGTPELKVKWTKDGKEVMPS
RQCSLSFVNNVSNIKIQSVQLDDGGIYLFEISNHISVCQCTVTLNVLEQIIPPAFIKSLS
DMEEILGSSVKIGCSISGSHPISVEWLKDGTKLSGRTKHKLIQDDNSVSLEIERLEKADT
GTYSCKLTNRAGSCECSGTLRVKAPPSFVVVPEPQAVIPNTTVRFKGTFTGTPPFTVKWF
REDTELITGPSCFIGLEGLSCFIDLYAVGLSNTGTYSCQVSNDAGSVKCTTSLLVKEPPE
FVQKLPATKFTKMGEPLRLECKVTGTPPLKISWYKNDTMVSDTPNMKMTFDDVMAVLEIF
STSHDDEGVYTCEAQNDAGIKSCSTTLSVKEPPTFHKAPTPPEGLKGKDASLSCELKGTV
PFEITWFKDKKQLKESRKYKFVSEGHSATLHILGLEASDAGEYECKASNNVGSDTCSAMV
KLREPPGFVKKLSNTTAVSGEEVTLVATVKGSEPIDVSWVQDKDHILRDSDNMKIAFVNN
QVTLTVFKADSTTAGKYTCRLKNDAGVAECMANLTVLDPAAILDKTESVSVTAGDAATLE
CTVTGTPELKPKWIKDGVELSSSRKHNITFSNKISSLKVLSAEKGDTGEYTFEIKNEVGS
DSCKMNLTVFDKIIPPTFSRKMKDTQSIVGKPVEMDCKVSGSAPLTIAWYHDGVEIMSGP
TYQISFAENTCTLKMPILKLSDSGSYKCIAANSAGTAETTASLVVKEPPSFVMPPQPVEA
LPGSHVKFSATVKGSAPLKVKWFKGTKEIVPGRACEIALRGDVATMELLNIDISHSGEYT
CQITNDVGKESCPVTLFVKEAARFVKKLKNLSVEIGKSMILECTYTGSPKILVKWQKDDQ
EIFSSYKYNITTTETSCILECLNSDKETAGKYTCEVTNDAGHDTCDATVSILGXFYFLES
LEPMEVTAGDAVCLKCQIGGTPVINVAWFKGDGKVRSSPSCRIEYSKGTACLKLTKVLKA
DTGEYICKAENSIGAASSSCYLTVQEAKTPPSFPKKITSIQQIEGHSVQFECRVSGSSPI
EISWLKDGEPLRSDSEYTMTFDDNSAVLKLAKGEMKHSGEYTCVATNSVGTASCRAKLTL
QEPRYPPVFDRKPLPVEVSVGDTVELECHMTGSLPIKVTWSKDHKDIRTGGNYKISCVEN
TPHLTILKVDKADSGRYSCHASNDVGKDSCSTEVTVKERKVPPSFTKKPSGTIEETEGKL
VKIEARVAGSQPMTVNWYKDGTEIFSSDSYDITFKTNVPVLCIKNSRVSHSGTYTCMVNN
DAGSASCEASVHIIEQKVPPRFDLPLKPVTVNLGDTLSLSCHVCGSPPIKIQWMKDRREL
MTSASTNITFVDGNAILEIGNVSKADAGDYLCKATNEAGSEFCKSRVTIKEKPGVPAPTP
TAPAAAEPVKKLDNLFFIEQPKSVRITEKGLATFIAKVGGDPIPNVKWMKGKWRQMTHGG
RVTLDQKGQEAKMEIREVTKSDSGQYRCVASNKHGEIECSTNLTVDLKKEIAPETVTLKK
TPSKQKSPKEDKDIDIIELLRNVDPKEYEKYARMYGITDYRGLLQAIEFLKKEKEEQYGR
PEVDRTGRDSEEDLSKLVADLQKRMEQTEPVTLINDITDQTTVANKEAVFECEIKINYPE
ITLSWYKGTQKLDTSDKYEINIVGDHHILKIKNCQSRDEGSYRIVCGPHISSAKLTVLEG
EVEQHMEDVAGKEGETCALTCQFSIPNAKTQWFRNGKLLEPHGRYTFTVANYTQKLSIKD
VRPEDQGEYTCKYKNLETTAHLWVEAEQIHFTKRIQNIVVRERQSATFECEVSFDNAVVT
WYKDTWELKESPKYTFRSEGRRHFMIIRNVTSDDEGVYSVIVRLEPRGEAKSTAELYLSG
KEIDLGRVPYEIPDSSIQVPEAPSAFTIEAESSAEYYHYEEKMEVQEYEIRREEKVVEEI
SVAALRIPVEEMIERKALGMREEVPAKVPEAVMESEETPKPVEEKELIPPKEAKKYVEEI
IIPVKVEEPKERPTPEEREEVPTPQPTPVTPIKVPESVVPEPKPRVPPPKPASVAEPKPE
AKPKPTAEAKPEPQPELKPIPPPEVPVEAMKPKTIQPEPPKAVPTKPEPEQAIVAPKEVT
PLKVPVEAKKAKLTEPEPPRAVPSKPEQVIAVPKEVTPQKVPMEAKKLKPAEPEPPRAVP
SKPVPEQVIVVPKEAPQKVPVEARKAKPTEPELPKAVPTKPEPEQVILVPKEVTPPKVQE
PSKKPEVLKKTDALPTKIDDKQTEVRKKKKEDEPSLKKEESPAPQKLKPEFLSVDPKELM
LDARLVFKPEVKPVLITEVKPEPKPEIKPVPKPEVKAEPKPEVKPEPKPEVKPEPKPEIK
PVPKPEVKAEPKPEVKPVPKPEVKAELKFEVKPEPKPEVKPEPKPEVMPVLKPEVKPEIK
LEVKPERKLVKSEPKPEVKPEPKPEVKPVPKPEVKPMLKPEPKLEVKPECTLVKPESKHE
PELKPASRKTESPPAKAHVEEETPKPTRPEPPRAMPTEPEKVSVVPKEVAPPKVYLEPTE
EELARKLVASFVPPKVDDQAEVPEAEKKPLPEKAPEKKKEVAPKVEKKPSPVPAEKISPI
EVERKKELPEPAVKPREKEISPVEDAEKGPVAAPAPVKKGKPLSKEEEKLEMPTLKPTKR
ISKDKEEEQEMLKLKKVHKPPPEKHEESEKVCAEAVTGVLITDSYEAEMYFEKYERIKKP
EEIRPEKDKKEPVKHAQEPEKMKPKEDKEEKPDLKKTVKIPKQGTADEPDLALKKVKKLP
SETKEPETVKLKPFEKPRKPELEPEKDTKKESKEREPISFGREREPVSFEKGERSRKEDI
PKEPEVPPKIVEPSKLQEKKPDEAVCRPVDKDKKGEMLDTPDTPSWKGKRIPQKDEEPEK
VQLKPFAKKLSAGSPAEKETPEPKERKPIKISPPSKLPKDGIIKEPQAPVKEDEKHKIPD
KEFDKRPDHVPQEKEKKEIPKKITPVKKDVTPKQEEKKPLITKKGSLPKEPEKKEEIVLK
PVELAKKGLEPKKTPSPKVDQGKPIELTPVAPVERKPSGTVAVAKKPLPEKVSPKDLIEA
VTLKKVPKKVSPKEEKTKETLPIKGKGETPVIKELSPTAVEMRKISTQMEEEVFEEEMIE
VGDEEEEETWGWELAPRDSYGSEDLEYLEEDALETPGMPGGRREGKPKEELGRGRGLTPR
QTPSPGEVGRRKGLKPGAGGEKPPGEAFGFQLKAVPLKFVKELKDIVLLEAESIGSSAVF
ECQISPSTAVTSWMKDDSNLRESPKHKFTSDGKDRKLAIIDVQLSDTGEYTCVAKLGNKE
KTSTAKLIVEELPVRFTKTLEEEVSVIKGQPMYLTCELSKDRDVVWKKDGKPLSDIPGKI
AINVIGLQRALTIQDSNDLDAAVYTCECENLQTQSNVKITEIIRDWLVRPLRDQHVKPKA
TATFKCELFKDTPNWKWFKGDEEIPTEPTDKTEVKKEGKEITLSIKNAQPNDADEFAIEV
EGRRYPAKLTLGEREAEILKPLASVEVVEKEEASFDTEISEDDVPGEWKLKGQVLTRSPT
CDIRVDGNKRFLTLKNVQLDQAGEVTYQALNAITSAMLTVKEIEMDFTVPLKDVTVPEKK
QAKFECSITKDVPKVLWYRGSDIVISDQKYDIIKDGKKHMLVINLCEFEDEGDYSIEVLG
KTSTAKLTVEGMRLKFISPMSDQTVKEGKTALFEVELSHENVPVTWYKNETKLHTSRTVL
THVDGKRHILELKEVTLDDICQIKAEAKGISTTANLTVLEGDAYFTVKLQDYTAVEKDEV
ILDCELSKDVPVKWFHNEMEIKSSKMVSMRAEGRRRILTIKKVADKDKGQYVCDCGTDKT
LATMNIEARDIKVVRPMYGVELFDGETARFEVELSEDDVHGQWKLKGEVLVQSQDVEIIE
DGSKHILTLYNCKVPQTGEVSFQGANAKCSANLKVKELPITFLTPLSDVQVYEKDEARFE
CEISREPKTFRWLKGSQELKADDKFEILSEVKRHTLVVKSAAYEDEAKYMFEAEDKRTSG
KLIIQGIRLEFVRPIKDVTVKERETAEFRIELSHEKVQVTWYKNDVRLHPSKVVHMSEDG
KIHTLSFKEVSIDDTSLIKAEALGKSCEAMLTVLEGEAYFTTKLQDYTAVEKDEVVLMCE
LSKPTAEVKWFKDGKEITPSKNILIKADGKKRILIVKRADKSNIGEYACDCGSDKTTAKL
NIEDRDIKVVRPLYSVEVTETETARFETEISEEDVHGNWKLKGDALHQSADCEIKEEGTK
HMLILYNVQMDMAGGVDFSAANAKSSAHLRVKARVIGLLRPLKDVTVTAGETATFDCELS
YEGISVEWFLGGTKLEPSDRVVTRAEGRNHTLTLRDVKLTEAGEIKLTAKDFQTQAELIV
KEPPVEFTKPLEDQTVEEEATAILECEVSKESAEVKWFKDGQEIHKTKKYEMVADGRHRK
LIIQDCTLDDSRTYTCDALHFKTSAFLNVEPPHVEFTKPLHDVEVMEKESAKFECEVSRE
SAKVRWFKDGNEIRKGKKYEIISKGVQRILIISKAVFDDEAEYECDAKTSRTSGMLTVIE
EEARFTKNLANVEGTETDSIKLISEVSKPSAEVTWYKGDQELPEGGRYEQITDGRRRILI
IQNLRMDDAGEYHCKLPSSQTTGNLRINELAAEFTSRPQSQEVVEGEKAQFVCSVSKDSY
EVKWLRGNKELQTDDKYEIISDGKRRVLVVKNCDHNDEGPFLALIGSTRASADLTVIEKL
RIITPLKDTKASEGQEIVLNCEVNTEAAKAKWLKNNDTMFESSKFIMGQKYNVFSLRIKN
ADKSDAAAYTVTLTNQRGEYVSSSANITVQEEDLRIIVPLDDIDTQEKKIVSFSCKVNKL
NVTVQWMKADQEITLNKRVVYRVDKDKHTLTIKDCSLADEGEYTVIAGADKSTAELIISE
APTDFTTQLQDQTIIEFEDAEFTCQLSKEKADVKWYRDGREIREGPRYQFERDGNVCTLR
IRECRLDDECEYACGVGDKKSRARLFVEEIPVKIIRPPMDVFEPPGSDIVYEVELNKDRV
EVKWLRNNMTIVQGDKYQMMSEGKIHRLQVCEIRPRDQGEYRVIAKDKDARAKLELAAVP
TIKTLDQDLVTDAGTPLTMSVPFNAYPQAEAEWFFDSISLPKENVHVSPDKTEYRMKDPK
KSEEGHYKIIIKNKHGQGEAFINLKVIDVPGPVKNLRVIDTADGEVSLAWDEPQNDGGSK
ILGYVVERRDVKRKTWTLATDRADSTEYTVIGLQKDSMYFFRVCARNRVGCGPNVETDEA
VLAKNKFDVPDAPQNVTVGNVSKFGATVSWNPPLFDGGAEITSYIIELRDRTSVQWSPVM
VTKPQDRKAVVNDVIENKEYIFRVRAENKAGPGKPSAATNPVKIMDPIERPSPPLNLTHS
EQTKEGCLLRWEPPLRNGGSIITGYIIERCEEDSDKWMRCNARLCPDLLYRVSGLKCGKK
YKYQVIAENAAGQSDPSNIVGPELADDPHFAPTLDLSAFKDGLEVIVPQPLIIRVPITGY
PTPTAKWTIGDTELTAGDRVSMVTKPTFTELVITPSVRPDKGRYFLTLENDVSSVSGEIE
VNVIASPSAPKDFKVAEVTRNHVHLMWEAPDHDGGSPITGYQVEKRDVSRKTWVKVIAGL
QDQEYTITDVVEGKEYLFRVIACNKCGPGEPAYIDDPVNVSSPATVPDPPENLKWRDKTA
NTIFLSWEPPKWDGGAPIKGYTVDKCQRGTDKWEPCGEPLPDLKFEVTGLTEGQWYAYRV
RALNRLGSGRPSKATDEILAVDPKEPPEIHLDAKLLAGLTAKAGTKIELPADITGKPEPK
IKWTKADLILKEDDRISIVTKPGHSTVYIAKTTREDSATYIVEAVNSSGRATATVDVNIL
DKPGPPAAFDISEITSQSCLLSWNPPRDDGGSRVTNYIVERRATDSEIWYKLSSTVKQTN
YKATKLINFKEYIFRVYAENQFGIGLPAEHAPITAKYIFDSPGPPYKVTASDIAKDAVTL
SWYEPDDDGGSPVTGYWVERFEPEADKWIRCNKQPISDTTFRVKGLPTRKKYKFRVLAEN
LAGPGKPSKETDQILIKDPIDPPWPPGKPSVKDVAKTSAFLQWTKPEHDGGAKIVSYIVE
LLKSGTVEWVRVVDGIPSLEYFLKGLMEKQEYSFRVRAVNAAGESEPSEPSDPVLCKERL
NPPSPPRWLEVVNISRSGAELKWTAPERDGGSPITNYIVEKRDVKRKGWQAVDTTVKELT
YTVTPLNEGSLYVFRVAAENVVGPSEYCELLDSVLAKDTFTTPGPPYALTVTGVSKTHVD
LKWEAPKNDGGRPILRYVIEKKEKLGTRWVKSAKTSGPDCKYRVTDVIEGTEVQFQVLAE
NEAGVGHPSEPTDIVVIEDPTGPPSPPQDLHVTEANRDHISIAWKAPERNGGSPVIGYHI
ELCEAGTEKWMRVNSRPVKELKYRAGEDEGILPEKQYIFRVRAVNSIGASDPSEISESVY
AKDSDCNPTIEFQTQDLVVVEGDKMHLPIPFKAVPSPKITWHKDGKEMKADDRISFRSDY
ISCHLEIPSCVHADAGQYKVTLENSLGATSGTINVKVIGLPGPCKEIVASDVTKNSCKVS
WEPPDYDGGSPVLHYILQRREAGRRTYVNVMSGENKISWPVKDLIQNGEYYFRVRAVNKI
GGGEFIELRNPVIAEDQKHPPDPPVDVETHNPSSESVTLTWKPPMYDGGCKIMGYILEKA
MKGQEKFERCNDFLVPVLSYTVKGLKQGKEYQFRVRAENAAGISDPSRSTPMIKATDAVD
RPKVFLSGSLQSGLSVRKGEEIRLTAYISGFPYPEITWTRNNSTIRPEALKKRPERPIRK
KKEKEPEKEEEKKQEEIKEDDKEKKEKEKEVEEPEEPEEEYHPSLNERLTIDNIREGESL
ICVKDVIRGDHGVFTIKVENDHGIASASCVVNVLDTPGPPVNLKFEEVRKDSLLCKWDPP
LDDGGSEILNYILERKDNSKVEMGWVTVTTTLRACKYPVTKLIEGKEYIFRVTAENRFGP
GRPCISKPVIAKNPFDPPEAPEKPEIVDITSNSMVVTWKEPKDNGCPIQGYWVEKREINS
THWTRVNRSIFNKLELNVEGLLEGLTYIFRVCAENMAGCGKFSPPSEPKTAQAPILPPGP
PIARVADTTDHSIIVEWDPPVDNGGSDIFGYHVDKLLAGTKEWTRATERPQKSLTFTVYG
VREGAKYTTRVMAVNCAGEGAPGITETVIVKNPAVIPVIELDVSVKGGFVVRAGDTLRIP
ANVTGRPKPSISWMVNDRALDKKRVEIEEVGQSNTLIIKNAQRGDSGRYQITAANPSAIK
SAWTTAEVVDVPGPVLELKPVVVTRKLMMLNWSDPDDDGGSDLTGFIIERKDPKSHTFRQ
PIETVASKCEIGGIVEGHEYIFRVVAKNKYGCGPPVDLGPILAVDPQAPPTSPEKFHYTE
RTKSSITLVWKPPRNDGGSPVLGYVVEKKRQDQPAFQRVNPELCTDLTMTVENLDELHMY
EFRAKAVNSIGESDPSIPMNVVIQDDEVPPHLHMLKHFKEDIIRVRKNEPVEIPVEITGL
PIPKVEWLKDDVLIPKSTERVLIETKEIDRLTEHTKLTIPAVARLDKGTYTITASNCMGT
VSHHITLEVLDRPTPPRNVALSNIRAESCYLTWDPPLDIGGSMLTNYIIEKKCLDVKDAE
KAEWVLVTNTIIDRKYGVRELETGGRYQFRVKAENKYGISDACKTEEVHIKDPFALPGPP
EKVTIAEHSTNDMLVTWEPPRDCGGSMIIGYWLEKREKGTSYWAKANKAMVSKRGMKGWE
FQVTRLAEGVEYEFRAMACNAAGIGPPSAVSESAFAIEPMTPPSMPAAPEIADKTKRSVT
LSWIPPAKDGGSPIKGYIIEKQDEGTSEWTRVNDADSLHPTTTFTVPNLQELKKYRFRII
AVNDIGESEPSPRTPEVLMEDVHTEPKLFLDIGAHELVNIPAGTPIKIPVTVKGRPTPKV
TWDFEGKAKTEIKDRLHNLPVDSQVESTDTTSALTIPVSLRSHSGRYTVTAKNKSGQKHI
NIRVIVLDVPGPPKELKITDITRTTMRLIWKLPDTDGGERIKSYFIEKRAVTAKAWTKVN
ASCASMAFVVPDLLEGQDYLFRVCAENRIGMGPFTETTEPARARDPISPPDPPAKVKINL
VTKNTVTLSWQPPKNNGGAPVTHYIIERLSWDTSGPQKETWKQCNKRDVEETTFIVEDLK
EGGEYEFRVKAVNEAGPSRPSVTVGPIIIKDQTFAPTIDLREALEGAETFDINITARIQG
CPFPTLVWQKAPLDKPDEKTNVHYDQHINKLVADDRCTLLIQQSKRDDSAVYTLTATNSF
GTASKDIRLTILGRPGPPVGPVKIGEIFAERIGLSWKPPIDDGGSKITNYVIEKREENRK
SWVHVSNDPKECAYTVQRLTEGHEYEFRIMAQNKYGVGPPLYSEPEKTRNLFTVPGQCDK
PTVSEITRESMTVEWEEPEYDGGSPVTGYWLERKETTSKRWTKVNRDPIRIRPLGVSHVV
TGLLEGAIYQFRVIAINAAGCGLPSLPSDPAVSRDPITPPGPPIPKVIDCTKSTVELEWI
PPMNDGGSKITGYFVEFKEEGKEEWVKAKDKEIRGTKFVVPGLKELGLYRFRVRAVNAAG
AGEPGEVTEVIEVKDRTIAPEVDLDATVKEKIVVHAGGVIRILAYVSGKPAPEITWNRDD
APLPKEAVVETTAISSALVIKNCLRKHQGIYTLTAKNEGGERNKAIIVEVLDVPGPVGQP
FSGTNLTNDSCKLTWYSPEDDGGSAITNYIIEKREADRRGWTSVTYTVTRHNAVVQGLID
GKAYFFRIAAENIIGRGPYTETASEVCIKDPVSVPERPEDLVVKAIKKDSITVAWRPPKY
DGGAEVTSYVLEVRQLGKDNYVQIASDNKLMDRQFTHEGLKEGASYEFRVSAVNQIGQGK
PSFSTKPIMCKVELEPPSLDLEFHDTLLVRVGQPCTLQGRYGGKPTPTIKWFKNDEELQA
NEDIVLTSTKKTLCLSIEKAKRDHSGKYTVAVENSIGTCKRICTVTVVDRPQPPEGPVVF
DEIYRDHMVISWKPPLDDGGSAVSNYIVEKRDTNRDLWMPVISSCTRTTCKVPKLIEGRE
YIIRICAQNIHGISDPLLSAETKAKDVFKVPDAPQQPVVKEVYKDTARISWEPPADGGKP
ITNYIVEKRETMSNRWVRAGTDRIFPKTEYWVPDLLKGCEYEFRVMAENVIGVGDPSPPT
KPVFAKDPIVVPSPPIKPMAIDKTKNSVTLSWEPPKDSGGGKIFGYLLEYQKSGTEEWLQ
VNQTPDSCQETTFKVTSLEDGALYRFRVKAVNKAGESEPANVPEPIRAQDRLEPPELLLE
MGMPREIKALAGTHIKIVAGIKGMPIPNVTWKKNDADVPPRAEIQTTGVRTKLEMRYCNR
SDCGDYTLNVENPAGSKTATCTVLVLDKPGPIQHLRVSDVRSDSAQLSWKDPEDNGGTRI
TNFVVEKKDIASTQWVPVCSTSKKRSQTAKHLMEGTSYMFRVAAENQFGRSEFVETTKPV
KAMNPLFPPGPPKDLHHVDVDKTEVWLQWNWPDRTGGSDITGFLVEYQEEGEKDWIVFKT
VSIPECHVTGLEEGKTYRFRVKAENAIGLSRPDTTVPVLCHEKLVPPIVEVDAKLIDGII
VKAGSTIRLPAIMRGIPIPSAKWVLDGEEIRSGGNIKIDTDNFSTVLNIADCTRNHTGVY
ILTVSNPAGSKTVSLNVTVLDVPAAPIGPVNILEVTPDSMVIEWRPPKDDGGSPVMNYVV
EKRESNKETWGGVSSGSTATRLKISRLQSGVEYVVRIRAENKMGIGAPLESAPTVAKHQF
EPPGHPGKPVASDIAEDAVTLAWTMPLYDGGSPINGYIIERRHKGGKWIRVNKTPCRDLR
FRVLGLFEGNDYEFRVFAENIAGFSGPSPISDPVKPCRPITVPGPPVNPKVKDYSCNYAD
LVWIKPTRDGGSPILGYIVECQKAGGEWEKVNADDLIKQCTYRVKGLTEGTEYRFRIRAV
NMIGEGETREVPESVIAQDILIPPEIEMDITCRTHLTVRVGHNINITGYVRARPDPVITW
SKGETVLERDKRTTLTNNFPVVHMRIKEATRADHGKYTLKAVNDSGEASVTITVNVLDRP
GHCRNLTLTYVTKNACMVNWDAPEDNGGTEITNYIVECREPSVRTWSMISSDCTNRKVKA
KLLENHEYFFRVTAENKCGPGPATETKTPILAIDPLQKPGEPEKFHVADFGKNFVFLKWQ
RPDYDGGNPNLGYILERKIKDAEKWESLHDGVLKDTFFMADKCTENQTYQFRVKTTNDAR
ESNWVMTSEVLVKEEIQKPVLDLKFAGTVVVKAGESVRLEAALRGKPQPEVKWVKDKATG
HNPRISIDTGADYSKFLMTKAKRSDTGKYIITATNLAGSFTAYATLSVLDIPGPVRDVRV
SGMSTDKCRVVWDPPEDDGGCEVDSYILEKCETRRMVWSTYSASVVTPYCNVTRLVEGNE
YIFRVRAENKMGTGPPMESKPVIARTQFSPPGPPDPPEVTKIGKDEMTVIWAPPENDGGK
SITGYILERKEKRAVRWVAVTKSPISERRMKVINLIPNHEYQYRVKAENEVGLGEPSKPS
RPTAAKDPIEPPGPPGSLKVVDSTKTSVTLGWSKPVYDGGAPIIGYLVEMRDKIEMEGEK
ERDPDEGWVKCNVGIQLVLTEFTISNLDERKQYEFRVSAQNQVGIGRPARLKDAVTPKEI
HEIPEIDLDASLRKGLSVRAGCPIRLFATIRGRPAPKVTWKRIGVDNVLRRGHVDQIDTM
TFLVIPESTREDSGKYSLTLSNPSGEKAVFVRVKILDTPGPVDGLEATDVTKTSCQLSWS
PPENDGGSPILNYIVEKREVDRKTWTNCTNDLKKTSFKITNLTPGIEYYFRVIAVNKYGI
GVPKDSPKSYLATDPMSEPDPPKKMDVLEITKNSATVGWLKPLRDGGAKINGYIVDYQEA
GQPEDKWTPYSVVKDLSIVIVGLKENTKYRFRVAARNSIGCSLPREAEGIFELKEHLMAP
KIIMPDVVTAKAGTKLKVEALVSGKPVPVTTWMRGSDDVVTSDRISVQKTLSSSTFMIKD
VSRKDSGYYSLTAENNISKVNQILRLIIYDIPGPPEGPLEILEVDIDACTLAWNQPTEDG
GSNITNYVVEKCDVTRGDWVPAVSNCTKTSCRVVKLTPGNEYGFRVRAENRFGISEPIYS
EKMIARYPFDPPSEPRNCYVKNVHKEYVVLSWERPANDGGSPIIGYSIERKERNSLLWVK
ANETLVRATEYSCSGLIEGLEYIFRVSAVNKAGQGKPSKPTEIITARTPVDPPGKPEVLD
VTRNSVSLVWNRPKHDGGSKLIGYYVESLKLTGDKWVRVNANSQNVPKEEYVVTGLEEGA
QYKFRIIAKTAISVSLPSEESDAITVIAEHVPPRIEISVEMKNLITVKAGTNVNLEAEVY
GKPLPKITWKRDGIPIKLVEGIKMSQKRHLFILELFSVTRKESGEYTIVAENPSGTKSGN
IKLKVLDKPGPPASIKISQVFADRVKLRWEPPLSDGGAEITNYIIDKRETSRANWAMVTS
NLSGQLTDCSVEKLIEGHEYEFRVSAENKYGVGDPIVTNSVIAKNPFDVPGPCDPPVITN
IIKDHMTVSWKAPADDGKAPILGYMVEKRETQELNWSKVNRRPVIDRTIKVGSLTEGSEY
EFRVIALNKAGLGKPSDASKAALAVDPLYPPGPPAFPKVVDSTHSSVTLSWTKPAYDGGC
EILGYLVEVKRADSEEWLKCNIPKNLQATKFLVSGLIDNTEYQFRVTAMNKIGYSEPSEV
PGKHLAQDILIAPEAELDADLRKALVLRAGVTMRIYVPIRGRPAPKVTWSKVNANLKERQ
GLTIDTTDWDTFVYCENINRYDAGKYVLTLENSSGTKSYTIVVKVLDTPGPPLNLTVKET
SKNHASITWYPPLIDGGSPVKSYVIEKRLAERKAWTCVAPECPKTSFRITNLEAGKAYCF
RVSAENVYGIGEGETAGPVKASEQPGPVTDFKPVLVTKDSCNLTWKKPISDGGSHIVAYA
LDISEGEDKWKQLMRSKQMQHTVKDLQEGKQYLFRVRAFNESSEGPPTELTVVAKDQVVL
PDCDLKGLPDSCYVAKEGSTIHITIPITGIPAPTVTWKKGGVTLGDSGRISVDSTVASTT
LLIRDCQRGDADKFYIILKNSAGTKESTINIKVVGKPGICSGPIIFDEITADGITLEWGP
PKDDGGSEISNYILEKRPSTSNKWVTIASAIQKNNMRVTRLHEGTEYLFRVCAENKYGVG
EFLKSDPVVAKHPFNAPEAPAPPNILSIHHESAIVSWSDPRDNGGSPITGYHVEFKDRNS
LLWRRASKTPLRVKECRVTGLVEGLEYEFRVMAINMAGLGKPSKPTEALVALDPIDPPGK
PEVISVTRNTVTLIWTAPTYDGGHRLTGYIVEKLEHPGKVWMKANHVNIQSCAFTVTDLQ
EGSMYNFRIRAKNAAGAISAPSEQTDTLVCRDEYEPPTITIDPEMKDGVTVKAGETIVIS
ASSILGKPPPTAVWSKGGRELKPSDVVQITSTPTSSTLSIKYANRKNTGEYTITASNPFG
IKEEKVKVKILDVPGPPGPIEVSSVSAEKCTLTWLPPIEDGGCAIKSYILEKRETSRLLW
TKLAENIMDCRHVATKLIKGNEYIFRVLAVNQYGIGDPTQSGPVKMVDSYGRFNXPSKPE
IDNISKNAVTISWKRPAVDGGSDIRGYSVERKEKRGMRWVRASKKTISDLRYKVTGLSEG
VEYEFRVTAENKAGFGEPSEPSQPVLTKDISYPPGPPSNPRITDTTKTTATFNWGRPFYD
GGLDVTGYIVEHKKEGHDDWVQDTATPLRITEFVVPNLQAGGKYSFRVCAINSEGRGEPA
EVEKVVELVDREELPDFELDAELRRTLVVRSGASIRIFVPIKGRPTPEVTWMKEDVPLKG
RAHIDTTESYTLVVIPECTRYDAGKYILTLENVAGKKTGFVNVRVVDTPGPPVNLKPREI
TKNSITLQWEIPIIDGGSKIINYIIEKREATRKAFSTLTTNCQKCSYKVTNLEEGAEYYF
RVLAENERGIGEPAETPEPIRASQAPSAPDNLIVTDVSKDTATLAWTKPRHDGGSRITGY
VIEAQKKDSDQWVHVTAIKALDYTATDLTENAEYVFRIFAVNSSGRSEPRECRPVVIKEQ
TTPPGFDLRGVYQKLVVAKAGDNVKVEIPILGRPRPSVVWKKKDRELKQTQRINIDNTAT
STILNINDIKQKDAGQYSMTGKNILGTVTETITVQVHDIPGPPTGPVKVDEVSSDYIIIS
WDAPENDGGVPINNYIVEMRETTGTNWVELAATVIRTTFKAARLTTGIEYQFRVKAQNRY
GVGPCIISEPVVAAYPFDVPGQPGIPQVVAFTKDSITISWNEPSSDGGSPILGYHIERKE
KNSILWQRISKALVVGNIFKSSGLMDAIAYEFRVIAENMAGLSKPSKSSEMAYALDPVDP
PSQPVAINITRHEVTLQWLKPEGDGGFPITGYTVEKRELPNGRWLKANFSNIHETSFTVS
GLTEDASYEFRVFARNSAGSISRPSKPSEVIICRDDIQEPMLDVDSSFSSIVVVKAGDIF
RLDANVTGRPIPSLVWTKDGKDLEDTAKIEIKTADFYTCLINKDSSRRDGGAFTLTASNP
GGFAKYVFNVKVLDRPGPPEGPLHVTDMTTEKCILSWLPPLQDGGAKIDYYIIQRRETSR
LTWTNVATDLQVNRYKVTKLLKGNEYIFRVMAVNKYGVGEPLESEPAVVTNPYVASDPPQ
APDVTTITKDSMVVCWGHPEYNGGSPINTYIIERRDKTGLRWVKCNKRTVTDLRFKVSGL
TPGHEYEFRVLAENAAGLSAPSPSSPFYKACDTIFQPGPPGNPRILDTTKSSITVAWNKP
VYDGGSDITGYIVETCLPEEDEWTVVTPREGLTGTSFTITNLTENQEYKINISALNSEGV
GEPASVPGSPKAEDRYLPPEIDLDSDLRKVVNVRASGTLRLFVPIKGRPAPEVKWSREHG
EPLDKACIEATSSFTSLVVDNVDRFDSGKYMLTVENSSGSKTAFVNVRVLDTPGAPQNLT
IKEITKDSVSLIWDPPIIDGGSRVRHYLVEKRESTRKAYSIVNASCPKTSCRIGDLQEGS
FYFFRILAENEYGIGLPVESAEPVKISEKPLPPGKVTLKEVTGSTVTLSWEKPEHDGGSR
ITGYIVEMQGKGSDKWTQVMTVKVTEAVIAGLTQGEEYSFRISATNEKGTSDPRPLSVPV
VAKDLVITPAFKHLFSTFSVLAGDDLKIDVPYVAQPKAAVTWLKDGIALKETTRVNAEVT
EKHLYLVIKEATRDDVGKYTIKITNAVGEAMTDIHVVVLDKPGPPIGPIKIDEVTADSVT
LSWQPPEYEGGCTINNYIVEKRDTSTTNWQIVSATVARTTIKAARLKTGCEYQFRIAAEN
RYGKSSLLLSEPVIAQYPFELPGAPGPPTIQSVTKESMVIVWSKPGNDGGSKILGYHIES
KERNSLLWVKQNKTIIPDTRFKVSGLEEGIEYEFRVYAENIVGLSKASKVSDIQVARDPC
DPPGKPEAVIVTRNSVTLRWTAPEFDGGSRVTGYIVEKKELPNGRWMKASFTNIIETEFV
VSGLVEEQRYEFRVIAKNAAGVSSVPSQSTGAITAKDEVEPPMIDLDAKYAQTIVINAGE
SFRIDAGIFGKPVPSVHWIKLGQELENTARLEIKNTDFTTSLSVKEAIRVDGGQYTLLLK
NVGGEKSVAVNVKVLDRPGPPDGPISIYGVTNEKCCISWKAPLHDGGAEVSHYTVERRET
SRLVWTVVESKVQTLNLKITKLLPGNEYIFRVIPVNKYGIGEPLESDPVIAANPFVTPDP
PTGVEVSNITKDSMVVTWERPTNDGGNAITGYVIEKRDKEGVRWIRCNKRVVSELRFRVT
GLLENRSYEFRVSAENAAGVGKPSAPTVYYKATDPIFRPGPPNNPKVVDISRTSVVLQWG
KPIYDGGCEIQGYIVEACESTSDEWTMCTPPTGIKETYFEIKKLLEKHEYKFRICAINKV
GVGENADIKGSVLVEDKLEAPDTDLDADLRKIITVRAGGSLRLFVPIRGRPTPEVKWGKA
EGEINETAQIDITSSYTSLVIENVNRFDSGKYTLQLENSSGSKSAFISVRVLDTPDAPTN
FHVKEITKNSITLTWEPPLLDGGAKIKNYIVEKRESTRKVYSTVASCNKMTYKIEQLEEG
KIYFFRVLAENEYGIGLPAKTPEPLKISEVPQPPGKISVLDVTRKSVSLSWEKPEHDGGS
RITHYEVEMQAKESEKWSLCAQVKSLDTTVTNLVQGEEYNFRVIAVNDKGKSDPRLLAHP
VLAKDLVIEPTVRTKLSTYSVQVGHDLKVEARISGHPKPTITWTKDGAVLKQTTRVNVAD
TAHHTTLSIKDATRDDGGMYNVTVANILGQKEAIIEIIILEKPGPPTGPVRIDEISAESI
TLSWDPPTYTGGCQISNYIVQKRDTTTTNWVVVSATVARTTLKVGNLKTGAEYQFRIFAE
NRYGKSYALDSEPVVAQYPFKEPGAPGTPFVSAFTKESMVVEWHKPISDGGSAILGYHLE
RKEKNSILWTKINKTLIQDTRFKTSPLEEGIEYEFRVSAENIVGIGKGSKVSEGCVALDP
CDPPGTPVPIIVTRHSILLRWTPPEYDGGSMVTGYVVEKRDLPDGRWMKASFANILENEF
TVTGLTEDSKYDFRVIARNGAGSVSKPSQTTGPITAKDEVVPPTYEIDSQYTQIISVNAG
DTFTLEASVLGKPVPTMQWFKGDVEVETSARTETKNTDFKAVLVVKDAIRVDGGQYTLHL
TNVGGTKSVSFNVRVLDRPGPPEGPLTVSNVTSEKCSLSWLPPIHDGGSNISHYVIQKRE
TSRLAWTVVSSDCGATMFKVTKLLKGNEYIFRVMGVNKFGVGEPLESSPVFMRNPYVPPG
PPRELEVTNISRDSMTVCWTRPETDGGNEIVGYIVEKRDRVGVRWTKCNKRRVTDLRFRV
TGLTEDHEYEFRLSAENAAGVGKPSSPTVYYKACDPTFKPGPPTNAHLVDTTKNSVTIEW
SRPIYDGGLEIQGYIVEICKADEEEWLTCTPPTGLNDTKFTITKLTEHQEYKIQICALNR
LGVGEPVALPGTVKPVDKMDPPEIELSSELRKGIVVRAGGSMRINIPFKGRPTPEINWTK
DDGDLPSKAQIEKGLDYTQLSIDICDRNDAGKYTLTLENSSGTKTAFVSVKVLDTPGAPQ
NLVVKDITRNYVTLVWEPPLIDGGAKIKNYIVDQRKSTRPAFSNITTKCTKTTLRVGDLT
EGGIYYFRVMAENEFGVGLPIETEDSVKTADPPLPVGKVTLTDVTKTTASLSWEKPDHDG
GNRIIGYYIEMQPKGSDDWVVATTTKTCEGTVTGLSTGREYLFRVSAYNDKGKSDPRALA
TPVTAKDITIEPTLQVTFNTYSVKCGEDLKVEIPVRGRPVPKVAWSKDEQALKETTRLNV
SSTATSTILSIKDANREDSGKYTVTATSSVGTASEEIGIIILDKPGPPVGPVKIEEISAN
YVVISWEPPVYTGGCQLNNYVVEKRDTTTTNWQTVSATIARTTIKISKLRTGVEYQFRVF
AENRYGKSSSLDSVPVVVSYPFSEPSAPGTPFVSSVTKDHMVIQWKPPSNNGGSAILGYH
IERKEKNSILWTKLNTLLLADTHFKTNGLEEGIEYEYRVYAENIAGMSPFSKVSESVVAR
DPCDPPGTPEAIVITRNLVTVQWTKPQYDGGTTVTGYIVERKKLPDGRWMKASFANIIDT
QFTITELTEGDRYEFRVIARNAAGILSEPSESTGPITAQDQIEAPSATLDSKFKDVIIVN
AGETFTIDADIAGKPIPDIIWLKDGKEIDSATPRMEIKSTITRTVLTVKDCIRVDGGHFV
LSLSNVGGTKLVTVNVKVLDRPGPPDGPLKVTGVKAEKCYLHWSHPTHDGGAAISHYIIE
KRETSRLSWTMVEPKIQAISYKVTKLLPGNEYIFRVRAVNKYGIGEPLESEPVIARNPFK
TPGPPSTPEASAVTKDSMVLTWERPEDDGGSPIESYVLEKRDKEGVRWTKCNKKTLSDLR
FRVTGLTEGHSYEFRVSAENAAGVGTPSEPSEYYKACDAIYPPGPPSNPKVTDHSSTTVS
LAWSRPIYDGGALVSGYIVEMKEASDDEWIVCTPPTGVQTTHFTVKMLKENAEYNFRICA
VNIEGAGDHVDVQGSVIAAEKLEAPEIELDADLRKIVTVRASATLRLFVTIRGRPEPEVK
WSKADGPLTERAQIEVTSSYTMLVIDNVDRFHTGKYVLTLENNSGTKSAFINVRVLDSPS
APVNLLVKDVKRDSVQLQWEAPHIDGGAKVTHYVVEKRESKRMAFTTVANNCVRNSFKVD
DLQEGGVYYFRVLAVNEFGVGLPVSTTESVKVSQAPLPPGKVTLVDVTRHTVSLSWEKPD
HDGGSKITGYIVEMLTKGSEKWTACATVKALEARIEGLTRGEEYSFRIVAMNDKGKSDPK
PLGAPVVAKDITIEPIIDLLFNTYSVKAGEDLKIDVPFRGRPHPEVTWKKDGHSLKQTTR
VNVLTSKSSSKITIKDTIREDAGKYEITLTNSIGIKSAEITVIVLDKPGPPISIRVDEVS
ADFISLSWDPPVYDGGCQINNYVVEKRDTTTTTWQIVSATVARTSIKISRLTQGTEYQFR
IAAENRYGKSHVVDSPPIVAQYSFSPPGPPADLQVANITKSGMLVTWKQPVSDGGSPIIG
YHLECKDQSSILWTKVTRNLVPDTQFKVTGLEEGLLYQYRVYAENIAGIGTCTKACDPVA
ARDPCDPPGQPIVMNITRTSVSLSWTKPENDGGAKVTGYIVERKELPDGRWLKCNFTNLQ
ETYFDVTGLIEDQRYDFHVIAKNAAGLLSEASEGTGPVTVKDDVDPPCITIEDKLRQLVV
IKAGDILKIDAEISGRPIPVISWTKDGKEIDAKARVEISSTRTTTTLIVRDCIRRDSGQY
VLTLQNVAGTRSLAVNCKVLDRPGPSSGPLEVIGMTAEKCSLSWGPPQENGGAEIQHYIV
EKRETSRLAWTLVYADMKATTCKVTKLLKGNEYIFRVLGVNKYGTGEALESDPVKAMDPF
TVPAAPTNVEVTSVTSDAMTICWERPVSDGGSSINGYVIEKREKSGLRWVRVNKKPVYDL
RVKASNLREGCEYEYRVYAENAAGLSAPSLPCPLTKAEDPLFLPSPPTKPKIIDSTKSTI
TLSWNKPLFDGGSPVTGYSVEYRKTNEDDWIVGVQHTKNTEFTVVGLTSGAEYVFMVRSV
NKIGPSEPSPETDPQVAKDREDEPVFLISNEMRKTLIVKDGSSFTLRVPFKGKPVPNVMW
NKPDVDLRVRAAIDTTDTCTSITVEQATRNDSGKYNVTLQNVAGTVTLTLTVKVLDSPGP
PASIVVKEVTKNSATVTWDTPENEGGAPVKNYLIDMREASKKGWTRVTDSCHRLTFKVTD
LQEGGVYYFRVTGENEYGMGVPLETKDGTKITEKPSPPEKLGVTEVTKDSVTLAWSKPEH
DGGSKITNYQVDALEKGQQKWIKCGVTKSMHFVVYGLRENAEYFFRVCAENHAGLSDPKD
MVMPVLVKDQLEAPEINMKNFQRNTVYVKAGSNLKVEIPLTGKPLPKVSLSKNDQILKST
MRFNSEVTPESLIITLRESVAHDAGRYDITASNSSGTTKSFINIVVLDRPSLPLGPVEIC
DTTEDSLSLKWLPPAYDGGSPITNYIVLKRETTTANWIEVSSAVARCTIKIMKLTTGVEY
QFRIRAENRFGISDHIDSSPVTVNLPYTIPDAPPTPWVSGVTRESITVNWKEPSSNGGSH
VFGYHLQMKDKNSIMWKKFNKTVIRATHCKVTNVSPGLIYEFKVAAENAAGTGPFSKISD
AVLAIDACEPPTDVRVTDITKSSISLAWQKPSYDGGSKLTGYIIEKKDSPKDRWSKVNLT
NVSDTKFTVSGLTQDESYEFRVLAKNAVGSISNPSAIVGPVTCVDTYGAPEIELPQEYLD
VLKYKAGEAVQLKVGIIAKPHPTIEWYKEGKELESGAQIIISNAADSTCISVKDATRLNT
GTYELKVRNSLGSAYAAIRVLIQDKPGPPVGEIQFKKITADTITIMWDPPADEGGAMVTH
YIVEKRESSRIMWSVISEKLEDCIVSVPRLIKGNEYIFRVRGVNKYGIGDPLESEPVVAQ
NAFVPPSQPSKPQVTMITRSTMTVVWERPSLDGGSDIDGYYLEKREKKSLQWFKVIKDPI
RDTRQKVSSLTEGNEYQYRVCAINKAGTGQYSDASIFYRAHDPIDPPSEPTKLKVVDSTK
TSITLGWVKPVYDGGSEITSYVVEQMKADDKEWVTISSKGEVRTTEYVVSHLKPGVYYYL
RVSAVNCAGTGRAIEMIQPVQAKDILEEADVDLDISMSTQYTVKAGRDVEIMIPLKGRPA
PNVTWRRGDRNISGDAKYTINNTEYSTTLIIPKVTRDDSGKYLLEIENGVGEPKTISISV
KVLDSPSACNKLAVKNVTRGKLTLSWEPPLIDGGAPITNYIIEKKDAKMKAYSIVTAECS
NTSYKVEGLSEEIAYFFRVSAENENGIGDTCETSEPVRATETPGAVKNLVMFDSTNTSVS
LAWTKPDHDGGSHISEYIIEKKTKEEDTWSVCGTCRCFKYELTHLKELSEVFFRVYAKNE
KGRSDFSQIGPITVKEFLIPPEANLIDYPSGELSVRIGQNVNIELPYKGKPKPTIQWMKD
DFPLKESEQIRFRQTDNKASLIVRNTGKENAGKYTLVLDNKLVKNFFDIKVITLGPPSAP
VGPIQFDEIKAQSIIISWNVPQEDGGGEITCYSVEKRETSQAAWKMVCSSVVRTTFKIPN
LVKGTEYQFRVRAENKYGVSEPLTSSDVVAQHQYKPPGPPGKPVVFNVTSDGMTVSWDAP
SFDGGSPVTGYHLEKKDRNSLLWMKVNSTVISGREYRVIGLIEGLEYSFRVYAQNNAGMS
PVSEQSKHKLAISPVDPPGTPNCIDVTRDSVTLQWEPPKRDGGSKIVAYSVERRQGRARW
LRCNFIDISECQFTVTGLACGDRFEFRVIARNAVGTVSPPSQSSGYIMTKDESVIPEIRF
SAEKTLTIKAGENIKLSCNISGRPVPQVTWYKDGKELDKMLVDITTVIGSSSLFIRDADR
ENRGVYTIEAKNSSGTKKEDVLVRVQDTPGPPEGPLRFTNISADKASLWWSPPENDGCAA
ITHYVIEKRETSRITWALVTSKCEDCSFTTTSLIKGNEYQFRVSAVNKFGVGKPLESDSI
VAKMQYTVPDAPGTPDCTHVTGNSITLCWTRPRFDGGNEIKHYILERREKKSLRWVKVSA
KRPITELRHRVTNLTEGNEYEFHVMAENGAGVGPPSGTSRLFKCREPTSVPSAPTVVKVI
DSTKTSVTLEWTKPVFDGGLPIIGYMIEMCKASLEEWHRVNSQTCLHTQYTVIELEPGEE
YKFRVCAVNGAGKGETTEIPNAVQAVDRLTSPEIDIGADFKQTHVVRSGGTVTLHIPFRG
KPAPLATWTKADGDLGVMVDINTTDTFSTLTIENCTRYDAGKYTLSLENNSGRKSITLTV
KVLDTPGPPGPLSFKDVTRGALTLMWDAPSSDGGSRIHHYIVEKREASRLTWQEVSLKCT
RQILRVTNLDTGVAYVFRVIAENQYGQGEPYEMSEPIIATEEPAPPKRLDIIDTTSSTAT
LVWMKPEHDGGSRITGYIVETRKKGSDHWVVGGQTKSLKMILEGLVENTEYEFRVKAQND
TGVSYPRDALTSVIIKEPRIEPTADLSGINKQLITCKTGNSFTIDIPISGRPAPKVTWKL
EEMKLKETDRVSIKTTKDRTTLLVKDAKRGDSGKYYLTLENAAGAKTFTITVIVFGRPSP
PSGPFEISGVTSESCVLTWSEPTDDGGTDITNYIVEKRESGQTSWQVVNSSVKRPTIKVT
HLTKYMEYTFRVCAENKFGVSKPIESEAIVAEHPFIPPSPPTRPDVVSVSANAISIKWDV
PYHDGGSKVTGYWIEKKERNTILWVRENKIPYLECHYKVSSLIEGLEYQFRVYAMNIAGL
SKASEASRPVLALNPVDPPGKPEVYDITRSSVSIRWSEPLNDGGSKIVGYVVERKASSDD
DETRWLKCNYTTITDNFFIITSLEEGVVYEFRVIARNGAGVHSMPSESTGFVTCKDEYTP
PKAELDSKLVGEIVTIRAGSDLVLDAAIGGKPEPKVFWSKGEKELELGDKYSLTYTSTRA
MAIIKSCDRNDTGKYILTVKNASGTKVAAVSVKVLDTPGPPEGKITISRVTEEKCTVSWK
MPIEDGGDTVTHYIVDRRETSRLNWVVMETECKTLSCVSTKLIKNNEYIFRVRGVNKYGP
GVPLESEPVIARNAYMIPTPPGAPEIAAAGKQHVIIEWLKPESDGGSEIKNYLVDKREKS
SVRWTRVNKTFTIYDTRLKIMGLLEGSEYQFRVAAVNAAGTSLPSDASEYVLCREPTYTP
APPSIPRITDSTKHSLTMSWTRPMYDGGSDVTGYVIEILEEGTEQWYRATQKILTTTEYT
AAGLTSNKKYSFRVAAVNAMGTGEFSQGTVETAPSERIEIPDIELPEDLKKTVCLRAGST
LHLNALILGRPMPVVTWRKTGIDLQSRGYIDTTESTTVLTVEKVHRYDAGKYTIEAENPS
GKKTVTILVKIYDTPGPCGAVKVKDYTKESVVITWDVPTVDGGAPINNYIIEKREASMKS
YKTVTNECKKTLYRITGLEEGIRYFFRVLPENIYGIGEPCEISDSVLVCEVPSVPQDLQV
IDVTKSTVTLGWEKPLHDGGSRLTNYIIEACKTGTDRWINIANVKASASQHTIASLNENE
QYMFRIRAENTRGLSEPRDLMSPVTIQEQRVMPKIDLAGMPLKIINVPAGRPIVLDIPIK
GRPPPTCSWFFGGVKMKDTLDRIKIETTVKYTKLTVRETTIDDTGDYTLEVKNDMGIATE
IIKVIILDKPGVPVGPMRIDEVDATSVTCSWNAPEKDGGANISGYVVEQRDAHRPGWLPI
SESVTRLAFKFSRLTEGMEYVFRVAATNRFGVGAFLQSEVVECKSAKTIPNAPSIPEIFD
VSHDGMTLTWRPPEDDGGSSIAGYIIERKEAGSDRWVRINKNPVTMTRYRSTGLVEGLEY
EYRVTAINSRGTGKPSLSSKPVIAMDPIEPPGIPLNPRVTDTTRTSVSLAWSPPEEEGGA
TIIGYLIEMQKVDQVEWTKCNTTPTKICEYTLTHMPQGAEYRFRVMACNAGGPGEPAEIP
GVIKVTEMLEYPDYELDKKYQEGYIVRQGGVIILSVPIKGKPYPICKWTKEGRDISHRAM
IATGEDRTELMIREAHRDDTGTYDLVLENKCGKKAVYIKVKVIGRPDPPEGPLEFDDIQA
RSVRVSWRPPSDDGGADVLGYIVERREVPKAAWYTVDSRVVDTSLVVKGLKENVEYHFRV
SAENQFGISRSLKSDESVMPKTPLCPPEPPSFPPEIMDVTKTSIGLSWSRPKDDGGSRVT
GYYVERRELSTEKWVRHNKTHITTTMYTLTGLIPDAQYQFRVVAQNDVGESEPGPVSEAI
VCKDPFDKPSQPGDIDIISITKDSITIHWLRPELDGGKEILGYWIEFRQAGESAWKKCNK
ERSKDRQFTMGGLMEATEYEFRVFAENETGLSRPRRTAMGIKTKLSVGEAPSLKEEMKDN
TTNLGESGTLSCQIIGRPLPEIKWYRYGKELMQSRKYKMSSDGRNHSLTVLTDEQEDEGL
YTCRAINDAGEVETSGKLFLQAAPQFHPGFPLKEKYYAGCGTSLRLHVVYIGRPIPQIMW
FYGKKPLKPSEDIIIENTDNYTHLVVRNVQRKTNAGKYKVQMSNKFGTIETVLRVEIQDK
PLMPEGPIVVEALLKNSVIISWKPPKDDGGSLITNYIVEKREAKEGEQWHLVSSSVSGTT
CRVLNLIESAGYYFRVSAQNQYGISESLEIPAVLIIKSPFEKPGIPHQPVVTSVSKDSCV
VTWKPPSSDGGAKIKSYYIEKREKKQNKWIAVTTEEIHETHYTVKGLIEGFEYEFRVKCE
NIGGESDWSEISEPVIPKSDTAPRAPFFKEELRDMCVKYRANATFVTKVIGYPKPVVKWY
KGGKEILPDGEKIKIQEFKGGYHQLVISNADENDVAVYQIRATNQEGSISTTVTLDVEVP
AKVHLPLHLQGMGAVHALRGEMVTIKIPISGKPDPAITWQKGQEILSNTSYHQVIVTRSF
TSLVFLKGVQRKDAGYYIICAKNRFGVDKQTVELDVADVPESPKDVKVSDIGRDTITLTW
TPPNNGGSEITSYIIEKCPVSGDRWIRVAQTSEAQYTVMSLFGKTKYQFRVIAENQFGFS
HPSVPTEPVTTREDKYAIRNYDEEVDEAREVTKEEAPHSKVKNVPSLYKISEELARCGHF
GIVHRCVEISSKKTFLAKMIKVKGADRELVAREIETLNIARHKNLLYLHESFDSLEEYVL
IYEFISGMDIFERLGTTFDLTEQEIVRYMRQVCQALKFLHGLNYGHFDIRPDNIVYATRK
SSTVKIIEMGQARLLTPGENIRIQFTAPEYCAPEIHNSDFVTTATDMWSVGVLAYVLLSG
INPFAAESSLKMIEHISNAEYIFDSEAFKEISTEGMDFIDRLLTKECKHRMTASEALEHP
WLKMKIENISSKVIKTLRHRRYYQSLVKKEWSTVISAARVAYGGGYRNQRNVSFGRVKIG
PPEQGLRAGPVMHGSAEEGGHVRFMCNIENYDRNTQVTWYFGSHKLTASHKYEINYANGI
ASIYVKDIEERDDGLYRCHVVSEDREDNAYAELFVESVRSYREYFLGRSLKKLKRRIDKT
KLLQRPPEFTLPLYNRTAYIGEDVRFGVTITVHPEPQVTWLKAGHRIKPDPEKYTFTRDK
GLYQLMIHNVELEDDSEYTVVANNRFGEDSCKARLTIKSHAVVEDTMRPMFKRLLANIDC
VEGQSVHFDLRVSGIPPPTLKWEKDGKLLEFRPQVEVVQQDSDYYVLHIRETLIEDSGIY
RVTATNSAGSASCQATLKVERLTYTRREFKSEGEKQIYVQNQIEKTLKMAQEFSATEMTI
LNPAAQEALKEAAELYKPAVSTKHVQGEFDISDKEDREIKKIKEEGRKIRMPYEIPDARV
HDPTVFEEDMGIKHFVPLSDMKWYKKLCDQYEIPERMERVVQKRQKRIRLSRWEQFYVMP
LPRITDQYRPRWHIPKLTLDDLETVRPARRSPSPESEVSFKLRRRSLGDLSDEEIIQPVE
DYLTKRRIEEEKQKLEEELELGFSASPPSGSPVHFELSALRRPSPRVVHKAEVKHVEETK
HVLMAEKHHGSPPPISHFIRRRRSLSPTYIELMRPVSELIRPPRVRVPVEAEEGEIIERR
SPTPERTRPRSPSPISPDRRSSRSSSRFERSARFDIMSRYEARKAALKSERKYQVVTQQP
FSLDHAPRITVRMRSHRVPSGQDTKFTMNVQAKPECEIQWFHNGQVIHESNKYRFTNMSG
VLTLHITDCQAEDSGTYRVVCTNAKGEASDYGTLDVSGGAFTTYSSRRRDEEAPTLFVPE
LTKTDYYHTTTIRASSASRTHLEIKESKTKITEIHEASASEKYESERLASSPIRHSSTEY
LSSTSYSSLERYTSLESKSRIDSTSTTAVTTKKVKATLSAQILTKPQSLIVSVGEFAKFT
CDIDGEPASSVTWMHEGRIVITSHRVQVTTTQYKSTFEISSVDFSDEGSYSVVVENSEGR
QEAKFTLTIYKPAPKEKVVAPSQVKPPEAAVKLPEPSAKTPVPVKSPEPLAKSPAPSVTS
SVKSPEPSVISPVPSVKFPEPSMKSPEPTGVKSPETEIKSPEGVKSPIRVKSPEPGTVGP
RVRSPLPVKSPEVKSPPRVKSPELITSPLKVKSPTGLKSPEPIASPPRVKSPTPVKSPEP
TSPPQRVKSPTGTKSPEPISSPLRVKSPLGMKSPEPSTSLQRVKTPPMAKSPEPLTSPKR
VKSPLTVKSPPKILQQLKAEASEDKVKMICVADSSVREVLWYKDSRKLSQSNHYQIHTAA
DGTCCLYISDLSENDKGEYSCEMTGEGGAVSRTSFSFVGQVFQSISKKVTTFVSTRMAVK
ESVSSKTQEGAEVLMKESAAVSSMQESFSSKSIHMESTMQETSFSSSTMAEMKFETMSMS
SMSSMTSESAYAMSSSSMMSSHSQAEGTTVRAILHSGQGSAPRIEALPEDISIETGKVLT
VACAFSGEPSPHIEWSRGGKTLPTAEESGRFHIETTEDLTTLIITGVKQSDAGLYTLKLS
NEHGSDMATVTINIRSL
NT seq 94374 nt NT seq  +upstreamnt  +downstreamnt
atgacaacacaggcgccaacgtttactcagccgcttcagagcgttgtggcacttgagggt
agtgctgcaacgttcgaagctcaagttagtggtaatccagttcctgaggtgagctggttt
tgtgatggccaggttcttactgctgctgctctgcccggcgctcagatctcgttcagcgaa
ggccgcgctgttctgaggatccctgccgtgacagttgcacacagcggaagattttctgtg
agagccactaatggcgctggacaagccactagcaccgctgaactcctggttacagcggaa
actgcaccgccaaacttcattcagagactacaaagcatgactgtgagacagggaagcaga
gtgagactggatgttcgtgttacgggaatccctacacctgtggtgaagttctacagagag
ggagctgagattcagagctccgccgactttcagattgttcaggatggagacctttacagt
ttgctgattgctgaggccttccctgaagactctggaacatactctgtcaatgctactaac
agcagcggacgtgctacctctactgcagaactactggttcaaggtgaggaggaagctgtg
cctgctaagaaaacaaagacagttatttcaacttctcagatttcaaagacccgccaaacc
agagtagaaaagaaaatggagactcactttgagtccacagctttgcaaatgcaagttgaa
ggaggcattgtaactcaacagctagcccataagacccctcctcgtgtgcctcctaaaccc
acgtccaaatcccctccatcacatttgactaaagtttcagctactcgccaccagtcgccc
tctcctgtgaggcacgtgaaggcccccacgccgactcctgtcagagctgtatcgccctcc
acaagactgtcagtatcacccatcagaccagtcaaatccccagttctaactcgcaggcag
gtcactccaggtgctgaggtcctgcccccttggaagcaggcaggctacgtgtctgagtct
agctatcaggctagcctgaaggccaaggtcacagagatgcactgggagacagctgtcact
gagcagaaacaacctgtccccaaagaggtatgggcactgctctggatagggaacgttgcc
ttcttgagatgtgaaataaattgctttgtgcgtatggaacagcaaagcatggatgacaaa
tctggtgcagttgccacagttgtggcagcagtagaccaggctcgtagccgccaccctccc
tctggctctacagagcctcacagtgtagaaagcagcactgctactctccttgcacctacg
attgaccagcagatgaaacccatggtggacgtttcgcctatggcagtgcatgagcaggct
aacattagagagatcacgggggctcgctctgaatgcattatggaaactatggaaacaagc
tctgcctcttacacacttgtctctcaggagaagggtgatggtaagaaggcaggtgccgtg
gctacggtgcttgctgctgtggaccaggcgcgagttcgaaagcctgtgcatgttgagagt
actgtgactcaagaggaaaccgctataaagcagcaggcagtgctcacggctaagcaacag
gtcacaagtagaacagaagagtttcaaatttctcctgctatgctgagggacacgtctgaa
aaatctgttcctgtcatacagatcccaagaactacagagattagtccgcaggtggacact
ggccttgcgccatccccgattccacatttcacagtttcaaaagttactgtccctaaacct
gatcatagctatgaggtctcgatagctggctctgctattgctactctgcagaaagagttg
tcctccacttctggtgttcaaaagatcatcaagcccgtcaagcctccaactcataaagcc
gtggagatgagagtgaccccagagctgacccctcctccctttaaagacattactgagaaa
tatcagtcacatttcaacacagagttacagagacagataggtgcttcatatgcaggggaa
tgggagaagcaggttgttgagacagcagcagttccttcagctgtcaagcaaccagttatg
cctccaacagttgttgttggcttgaagaacatgactgttactgagggagagtcagtgact
ctggaatgccagatctctggccatcccacaccaggcattatgtggttcagggaggactac
cggattgagagctccattgacttccagatcacatatgagaaaacttatgcccgcttagtg
atccgggaggcctttgctgaggatagtggccgattcacttgcactgctaccagcgaggct
ggaactataagcacctcttgctacctgcttgtgcaagtatgtgaagaaattgagggtcga
gaagagattacgatggagaaacatattgaaactaaagaagaggccgtgtcagaagtgagc
gctgtgtccaagaccatcgaagtcggaacagctgtggctccattttttgtgaggaagctg
gctacacagaaactggtggaaggtggaagtgtggtctttgattgccagattggagggaac
cccaaaccccacatctactggaagaagaatggtgtcccactcaccaccggatacaggtat
agagttagctacaataaagacacaggggaatgcaaattggagatctctatgacttttgct
gacgatgcaggagagtacaccatctctgctaggaatcagcatggagaggtttcagcctcc
accagcctgctggaggaagaggaatatgaagcttacatgaaaacacaggaagtgatatac
aaaacagaagtaactacagcagtggtaccagagcccagagtggcagatgtagcccctgag
atgctaaggagattgcctcaacaaccacagatgatgcagacttttatctcagagaaggaa
ttccatatatctgctattgagcagagaataatccaggagattgaggttcagatcctaaag
attacctatcgggagctggtaatagaggatggagaggagatgctgatgaacgtggctgag
catgaggctgtaggatcctcattcagtactccagtcaaaagctacagaatcatggaggga
atgggggttacattccattgcaaaatggaaggaactcccttgccaaagattgcatggtac
aaagatgggaagcgcatcaagcatggaggtcgttatcagatggaggttcttcaggatggt
agaaccagtctgcgtattccggtggtgcttccagaagatgagggagtctacacagcttta
gctagtaacatgaagggtaatgcagtctgctctggaaagctctatgtggagtctacagct
tctgttcaaccctactatcctcaggcagaggcagtgaggagagtacagtctgaatcgccc
atgtctgcacggtcaattagcctctctcctggacactcgccggctcgttctgttagtcgt
tctcctggacgatcacctgctcgtaggctggatgagacagatgaatcccagctggaaagg
ctttacaaacctgtgtttgttatgaaaccatcatctttcaggtgctctgaaggacaaact
gcaagatttgatctgaaagttgttggaagacccatgcctgacactttctggtttcataat
gggcaacaagtggttaatgactacacccacaagattgtggtgaaggaagacggaactcag
tcattgattgtggttcctgctatgcctcaagactctggagaatggacagttgttgctcag
aacagagctggaaaaactactgtttctatgactcttactgtagaagctaaagaaaacttg
gttagaccacaatttattgaaaagctgaaaaatctcagtgtcaaggagggaactttggtt
gaactggctgtcaaagccattggaaaccctcgccctgacattgtatggctgaaaaacagt
gacatcatctctcctcacaagtaccctcatattaagattgagggtacaaagggtgaggca
catttcaagatcccccaaatcactggttctgatagtgcatggtacacagccactgctatt
aacaaagctggccgagatacaacacgctgcagagtcaatgttgaggtggagtttgccgaa
cctgaaccagagagaaaactcattattcctaagggaatctacaaggctaaggaaattgct
gcaccagaactggagccgctgcatctccgctatggtcaagaacaatgggaggagggtgac
ctttatgacaaggagaaacagcagaagcctcatttcaaaaagaaactgacttctgtcaga
ctcaagcgttttggtcctgtgcattttgaatgcagactgacccctattggtgatcccaac
atggttgttgagtggttgcatgatgggaaacccttggcagctgctaataggttacgcatg
attaatgaatttggctattgcagtcttgactatgaagttgcttattctagggatagtggt
gtcattacttgcagagccaccaacaaatttggtgttgatcagacctctgctaccctaatt
gtgaaagatgagaagagtcttgttgaggaaagtcagctgccagagggtaggagggtaccg
agaattgatgaaatggagcgcattgctcatgaaggagctctttcaggtgttactgcagaa
gaactgatggaaaaaactaagcctgagattgtcttgctcccagaacccattagtgttctg
gagggggaaaatgcaaaataccgttgcagagtaactggctacccaaccccaaaagtcaat
tggtacctaaatggacaacttattcgcaagagcaaacgattcagactacagtatgatggc
attcactatcttgagattacagactgtaaatcttatgattcaggggaagtcaaagtattg
gctgagaaccctgagggtactgctgagcatatcgttaagctggagatcaaacagagggag
gattttaggtcaatgctgcggcgtgcccctgaggtgaaggttccagaacttcctggtcca
gaggctggtaaagtatcctttgatgttataaaggtggacaaacctgttgagccatcacaa
gccaaagaagtggtaaaactgaggagggcagagagagttattcacgaaagatctccagaa
gagacagaggaattgagaagcaaattcaaacgcaggactgaagaaggctattatgaggcc
atctcctcagtggagtttaaatctcgcaaaaaggatgagtcctatgaagaaatgttgagg
aaaagaaaggaggagcttctgcactggaccaaggaaatacccgaatctgagaagaagaag
gaagaagaagaacgcaaacttactattcctactatcagacctgagaaaataactctctct
cccagcatggaggcaccaaaaatctttgaacgaattcagagccaaactgttggcctgggt
gaagaagtccgctttcgttgcagagttgttggaaaaccagatccagaatgccaatggttc
aagaatggaatcttgctagaaaaatcagaccgtatttactggtattggcctgaggaccat
gtctgtgagctggttattagggatgtcgcaacagaagactcagctagcatcatggtgaaa
gccattaatatcgcaggagagacctcaagccatgccttcttgcttgtccaagccaagcaa
gttgtcagcttcactcaacaactggaggatatgtatgccaaagagaaggacaccattatg
acctttgaatgtgagacaaatgagccttttgtcaaggtcaaatggctgaagaacaatgca
gagattttctctggagacaagtacaggatgcactctgacagaaaggtgcacttcctgtct
gtacttgtcatcgacatgagtgatgatgctgaatacagttgcactcttgttgaggatgac
cacataagaacatctgcgagactccatgttgaaggtgcaccactggaaattttgaagact
atggataacattgaagtaccagagacttactctggagaatttgagtgtgaactgtcccga
gaggacgctgaaggcacctggtactttgaaaacaaagagatcaccccaagccttaaatat
gttgtgtcctcccgtcgtggacgccactgcctgtgtgtaaaagatgtgaagaaggaagac
caaggcaaatacacattcaaagtgggggatctaaagaccactgcctccttgaagatgaaa
ttacgcccagttacactactgcaaggcctctctgacctgaccatctgtgaaggtgatatt
gctcaactggaagtccgattctctcaggagaatgtggagggaacttggatgaagaatggt
caacctatctctgctactgacagggttcacattgttattgacaaacttgtacacaaactc
ctggttgaaaatgtcaccaaagacgatgctggaatgtactcctttgttgttcctgctcag
aacatttctactgcaggaaaactgattgtgcagactattggtattataactcctctaaag
gatgttagcacagtggaaggcacaaaggctgttctagaagcgaaaatttcagctgctgat
gtgatctctgtgaagtggtaccaaaatgaaaagctgctgacggctagtgacagagtccag
atggttgctaagggttccaaacaacgtttagtgttgaacaggacctatgcctctgatgaa
ggacagtacagactggttgttggcagagttgattcatcttgcagactttctgtccagaag
gtcagtatcgtaaagcacatggaggactgtgtttgtactgaaacccagaatgtcaccttt
gaggttgagttatctcactctggcattgatgctttctggacttttaaaaatcaacctctt
aaagctggtcccagatacaagattgagtccaagggcacaaaatatagcctcacagttatc
aatgccatgaaggatgaggagggagtttatacttttgcagctggtgaaaagacatcaagt
gcaaaacttattgtatcaggtggtgccataaacagacccctgcaggatgtaactgttgct
gagtcccagactgctgagctggagtgtgaagttgccaacccttctgctgagggcaagtgg
cttaaggatggacatcctgttagctttagtgacaatgtaaggagcgaagagattggtgct
gtgagacgccttgttattgtcatcacccgaccacaggatattggagagtacacttaccag
gtggcaaactctaagacctcagccaacctgaaagttgaagctgtgaagatcaagaagaca
ctaaagaaccaaactgttactgagacacaagaggcagcgttcagtctggaacttacccat
ttggatgtgaaaggtgcccagtggatcaagaatggagtggaaattctcccaagtgataaa
tatgagattacaatagatggaatggtgcacaccttaaagatcaaagactgtaacgcccag
gatgaatcggtttatggattcaaactgggcaagctttctgctaatgctagactgaacgtt
gagacaattaaaattgtgaagaagccaaaagatgtgacttcactgctcagtgccactgcc
tcctttgagttgagcttatcccatgataatatcccagttaaatggatgttcaagaaccaa
gagctcaagcaaactgaaaatattcagatattttcagagaggaaagcgcataaggtggtc
atagccaatgttgatgaagacatggcaggagaatacacagctatagtaggacatttgcag
tgtagtgcatttttgcatgttgaatctttgagggtcacaaaaaccatgaagaatgttgag
gttccagagacccatactgccacctttgaatgtgaggtttcacatttcaatgtcccatct
acctggctgaaaaatggagttgagattgagatgagtgagaagttcagaattgtggtgcag
ggcaagctccaccagctcaagatcatgaacaccagcagagatgatgctgcagagtacacg
ttcgtgtgtggaaatgacagagtgtcagccaccctgactgttaaccctatactcatcaca
tcaatgctcaaggacctcaatgctcaggagaaggacaccataacatttgaagtaactgtc
aactatgaaggcatcacctacaagtggttgaagaatggtgtagagattaggtcaactgat
agatgtcagacccgttctaggcagctcactcacacgctcaccatccgtaatgtgaatttt
ggtgatagtgcagagtacaagtatgttgctggatctgctgagacatcagcaaacttgttt
gttgaggctcgtgtcattgagttcaccaaacacatcaaagacatcaaagttacagaaaag
aaaaaggccatctttgaatgtgagctctctgagcctaatgttcaggtgacatggatgaaa
gatggacaggaaattgagataacagaaaggtataaagtttccacagacaaatacatacag
cgcttgatgatacagagtgttcgcatgtcagacactggtgaatactctgtcgtcgctgga
tcaagtatttctatggctcacctcacagtagagggcaaggatgttcgcattactgaacct
gctcagaaagaaataactgtgctggaaaggcagcgagtagtgttggagttcgaagtcaat
gaagatgacattgaaggccgctggctgagaaacggtgttgaaatccaacttgcaattgat
aagcgtttcagctatgccactattaggaaaattcatcgcttgaccattgctgaaacctac
aggagtgatgcaggagaatacactttcattgctgggaaaaacaggagtgtggtcaccctg
catgtcaacatccctgagcctccccagatcctcagacacatgttggatctgtctgtagag
gctggaaaacctgcacgcttctctgtggaagtgactggcatccctcagcctcaggtgtca
tggtataagaactctcagatgctgtcttctggattcaagtgcaagttcctgagggaggga
aatgagtacactctgctgctcattgaggtcttcccagaggatgcagctcagtacacttgt
gaggccaaaaatgactatggtcaggccaccagctctgcttcactgaatgttgaagttcca
gaggttgtttcccctgacactggcgcacctttgaccccacctgtgattatatctccaata
caaaacacctcagctaaagaaggagcatctgcgagattccagtgtcgggtgtctggagag
gatctgacaattacctggtattgcaaagacaaagagatcaagcagtcaagcttcttccga
atgtctcagtttgatgataactgcctgctggagattgccagagtttatgcggaggatgag
ggagagtacagctgtgttgctcgcagttctgctggaatggtctcttgctctgcagtactg
aatctggaagttaaaaaagtgcatgaagagattgaaactaaaattgaagaagaattcaaa
gaattttctagcttgacagtgaagaccatgggggaagaagaagaaacctacagttctact
ctacaattacctgaaaaagctaaaacacttgaactcaagccagagcaaaaacgttactct
agttctttggaaaagaaaaaggaaaaacccatttttctaacccaacttgcaccttcagaa
gtcactattgggagctcagctaggtttactgtcactgtatctggttttccaaagcctaaa
gttcagtggttccacaatggcaaagtcattacttcttcatctgtatacaagtttgttgaa
gaaagagatgagtacagtctgattatcactaaggtaaaaaaagaatatgagggagaatac
tcatgcactgcaagtaacagatttggtcaaactacttgcacaacaaccctaaaagtacaa
gtcactgatttatcaccagcagagaagtgggttgagcacatgtttaaagtacctggagag
ccaccgcggtttaccacacagatcgtacctgttcagtgtgctgaggggtgtgaggctaaa
tttgaatacaaagtgacaggaactccctgtccaaaaattcagtggtttaaaggtagcgat
gaaattctgcccagcccagacttttgtattgtaactgatccagatggtactggttttctt
ataatgattgatatccagcagagtgatagaggcctttacacttgcagggcttccaatccc
tttggggaggctacttgtagtgctgaattaattgtgttccagaaaagttattcagtatct
catcaacagcagctgactcaacagaaaacttataaaatgtccatgactgaagaggcgact
gaatctcgcttgtacagtgtgagtcttcctgggcaagccagagtcagtctgcaggaaggg
caaaagatgatttataccattggcacagaagataggcagactgtagcaagtgagcaagtt
ggttctcttcatgaaatagatgtttcatctgccactgtgcacaaggagcaggtgactcac
caggctgcagttctgcagtctcatgagatgcaggaaagagtaactgtagcatccagacag
ccacaaacagctgtggcaacacctttgagacagctccacatggctgcaatgacatctgca
gttcaagaaagccaaggcttcacagaggagcaccttgatcgcattaaaagtcctgaggtt
acggaattgaagagtgcaaaggagcagacttcaaggctaatgtctgccataacagagagt
gtaatgcctctaacaattgttaaaacacagccactaaccagtcaagaaaaagagcaaaca
aaagcaattactgagcccaaatacccattttcaagtcatcaggtagaatcaacactccca
attgtaaaagagcaatcaaagactataccacagacagaggcagaaaagagctatcaagtt
aaggagggtatgaaaatattgtatgcagcagtttcagatgagaagcaacaaataacagat
gtccatgctaaagatttgtcagtgttagatatagcctctcagtcctcagtaaagaaggaa
tcccccaaaccagccattctttcagtgagtgagaccaaacaaatgctatcaaaagagcaa
aaattctttatgcacagacctgataagcagactgcagctctggctaaggatacagtatta
agatcagctcttgttgctgaggatgttaatgaatttcaagctgaaaaaacaagtgtaatt
ccaggtttggatagtatggtttcagttcaggcacagagggaagaggaacagatacttaac
ttacagatttttgcagatcagactagtcttccttctgagggtagattcagtagtgagaag
ccaagtcctgagcaagcagactctagaaaaagtcctactcttttgcacacagtgtcaaca
gatgaacagcagaccattacttgtgaagggtcatcacagttctcaaccgaagagacatca
gtttttatacagcctcataaagaggccctggcccctttgcatctgcaggcagttcaagca
gagagcatgttatcaaaagaggggatcctctcaatagaaaaaacagaccaacagatggca
gtgcagagacaggaaaaggcccgtaaacatgcagttaccacagaggagaaaagggaactc
acagcagattattccagaggtctggaagtttctgctacaggagttcattctgatatcaag
aaagaaccaaaacctcaaagcaatttgcaagtcatcacagaaccaatgcagctaccaaag
gagacaccattttcaagtgaaactaagcagcaacgtgcattagtgcaaaaggaggatcgc
tggaatattattaatgccatgtccatatcagacatacaagatctggaggaaggacacaca
gagaatttatgcgcaccagaaaaatatacatgcttggctgaaatggagcctaaaatacca
ttagaatctcttcatgttgaggagaaggaaatctcaactgaaagcagcgttactcttgat
gccgcggaacaagactttgctgttcaaattcaagagggtcagtcgattagaaagtcaata
ttaatggatgaaaagctccttttaagaggtgaactgtctcaggatattacaaaatcacaa
acaactacagcaacagttagtcaacagcagatggatgttctgttactatcagagtccaga
gaaagccagacccttccaaaggaacttacttttgtgattccagcacctaaagcacacagc
ttagatataaagcctcagttgaaaaatatgcttgcatcagctgttgctcaagatcaacca
ttaatactggcagatgtggtcaagcaattggatgttgttgaagtacaggaggtcagagtt
caaaggcagcttaggtataccatgttcacatatctcatcacaactgcaggagcccccata
gagatcacaatttctttcgagggcgagtaccctcagactgctgatcttaagagtgaactt
caggctgctttgtattccattatctatcgtgagcagcaggttctcacctccgaacaacct
ggagcaatgcacattgacaggcctcagagattacaacttagtagggctgctgctaaagaa
aagctctcaccaatggttgagactgtgcaattaactgaaaatacagaaactttttttcca
cctaaaacacaatcagctgctctgaagtctgaagatgtaacctctttccagtctgtaaag
gctcagaaacaaactgttgtgcaaggctcaaaaagtctagtgattcaggaaaccactaca
aaaatggaattaaagcagtctgttcaggttgaaagacaggaaatcagatctgtgacagta
aaaagccaagatcgagatattggtactgcagatatcaccaccgatgggtcctttgtgcca
gtcccagttgagcagtctgacattctcattcagagggaagacacacaggaatatctgaca
gaagagaccatcaaattacaaaaagcaaaggttagggaggaatacccagtctttgaaagc
tctttgaaagatgtcatcatagatgaacactctaaagtcacattttctgtgactacaaga
catgtctcaaaagtgaattggctttttaatggaaaaccagttaagtctggcaaagagttc
aagtgtttacaagataaggacacttatatgcttgtaatcgataaagttatcaaggaaaaa
catgaaggagaatacacgtttgaggctgtgaatgaagctggcaagacttcaacaacatca
aggctcacagtggtctcaagagttccacctgttttcaaaagaaaaatcaatgctctggag
gccagtgtaggaagccctgtcacttttgaatgtgagattgaagatgcacccaacgtgacc
ttcaaatggttcaagtatggctcagagatcagacacagtgacaagtacaagatcatcagc
catttaaccacatcatctctagagctcttgagtccaacaaaggcagacagtggcgagtac
acctgcacagctttgaaccaacatggtagagacagctgctctgctaacctgaatgtgaca
gaggtttttcctccagaatttgtatcaaagcctgatccaattacttcatttgtggccaaa
caagcaaaattccattgtgtaatcactggttcggcaccagtgaatgttgtctggcacaag
gacaacattgccatttcacataatgagcactacaaagtgttcgttgaaaagaacaagtat
tgtcttgagatcacaaatcttgagcaaagtgaccagggaacatacctttgcaaagcttca
aatagtgttggcacagctacgtgctgcactgagctgagagttatcgacaaacccagcttt
gtgaagacctttgagccaacttttgtagcggtggataattcactgcggctcgagtgtcag
gtgaatgaagatacaggtgtgttcatcacctggatgagggatggcaagagactccataat
acaatggatagcaaaatttcttttgaagacagagtggcgtgccttgagataccaaaggcc
aagcttaaagatacaggcacttatgtttgtactgctgcaaatgacgctggaagcagcatt
cactcttctgtgataaatgtacaagaacctccaaaatttgtaaagagattggagtctaag
gtcttatggaaacagggaacatctgcacgattgttgtgtactgttaaaggatctcctgag
ctccatgtctcttggtttttaaatgacaagcaactcagctccagtgagagacataaaatt
accttcaaagatggtcaagctgcacttgagattattggccctactgtgtctgacagtgga
aattacacttgtgaagtaatgaatgaggctggctgtgaaagctgcagtacccagctcact
gtcaaagaaccccctgctttcaaaaaggaattggaaacagtggaggtggtgaagggtctt
acagcccatcttgagtgtgaagttacaggcactgctccatttgaagtgacctggttgaag
aataagaaaacagtgaacactgataaaaaacacaaaattgtgtcaaaggataccattttg
tatttggaaatacagtcctttgacagcacggatgttggagattaccagtgttgtatttct
aatgatgttggtaaagtaacttctaaatcagtggcaaaactgaaagacccgccatctttt
gtaaagagggtcgaaagcacaactgcaattttgggcagtgctgtaaaactgcagggtact
cttaaaggctccacccctattactgttaaatggctcagggactctgagatactcagagat
gatgaccctaatattaccatgatttttgaaagtaacattgctgttttggcaatcaaggaa
gtaaccataaaacatggtggaaagtatacatgccaagctgaaaatgaggctggtcaacaa
aaaagtgaagccacattatcagttcaagaacctgctagaattgttgataaagcaccatcc
atcagtgtaacagcaggagactctgcaactttggattgcactgtctcaggaagtccagat
ctcaaagtaaaatggctccgtgatggcaaggagatgacagcgagccgaaaatacaaaatc
tcttttaaagacaatgtagcaagcttaaaatttctctcagcagagaggggagacagctgt
gaatacacacttgaagtttctaatcgggtcggaaaagaccattgttcttgctcagtcaca
gttcttgataaaattatacctccaaccttcacaaaaattcttaaaaaggttgatggaaat
gttgggggcagtgttcagatggaatgcaaggtgtcagggtcacagcccatgacaatatct
tggtttaaagaggaaaaggagatcacaactgggatgaagtaccaaactgaattcagagaa
agcactgctacattgaaaatatctaatttagagactgctgatactggggttttcacctgc
catgctactaatgcagcagggcacagagagacaagtggaacagtatctgttaaagagcct
ccagtcttcacattaaagcctgaatcccaagaagtaataccaggctctactgttgttctg
aaagccactttcactggaacagcaccttttactatcaaatggttcagagaagagaatgag
atgttaaccggaggcacttgtttcattaagaaagaagccttttcaagtacactggagttg
cactctgtgaagccatctcattcctcgacatatacttgccaagtggctaacgatgcaggg
aaggtttcatgcaccgctgtcttatttgtaaaagaacctccaaggtttgtgatgaaactt
gacccagccaaattagcaatgaatggaactgctgtgtttttggagtgtaaagtaactggc
agtcctgagattactatgaagtggtacaaaaatgagatggaaatcacccaaagtgctaaa
tatcaaatgaccttcagtgactcagttgctacactgcaggtgcccaattgtagtgttgaa
gatagtggagattatatttgcgtagcatccagtgatgctggcagtgacagatgcagttgc
ttggtaacagttaaagaacctcctgtatttgtgaaattattcgaatccaaagaagttgtc
aaaggctctgatgttgtgctggagggatctatctcaggttcacctccatttgaagtctca
tgtatcaaaaactcaaagcagatcagaaacgatcggcggcatgtcattagcatgaagaac
gatgtagtgagtctccagattctcaaatttgaagtcggagatgctggcaaatatcagtgc
actgtagggaatgaagtaggacagacgtcatgtgattgtgaaattgtactgaaagagcca
ccatcatttgtgcagaagctagataccatgaacatccttcttggcagtgagcttactatg
cagtgtgttctgaaaggctcactgcctatgacagtgttatggacaaaagatgaccatgag
gtcaaagacactgagcatgtccagatgtcctttgaaaacagaacagcacttctgcatgtg
tctagtgtacagtcaaaacatggtggaaaatacacttgccatgcgcagaatgaagctgga
agtcagaagtgtacagcagctttggtggtcaaagagccagcaaatatcacagagcaggca
aagtctatcagtgtcactgtaggagaccctgctactctggagtgtaggttctcaggcact
aaagccttaaaaagcaagtggatgaaggatggaaaagagctgacttcaggcaaaaaatac
aaagtacatagcactgataagaactgcacattaaagatcctgtctgcggagcggtgtgat
gaaggcgaatatatgtttgaagtttcaaatgatgttggcaagagcacttgtgaggctttt
gtaactgtactagatcaaataattaagccttctttcacaagaaaactgaaggaaatggag
attattaaaggatcctttacacaattggaatgtctggtgtctggatccctacctataatg
atcacttggtttaaggagaacaaggagatagagacagatgaaaaacacaaatgcattttc
tttgaaaatgcagcatctttggaaatcaatcgtcttgatagttctgatagtggcaattat
acttgcattgctacaaacaaagcaggcagagaccagtgttctggtgtcttaaaagttaaa
gaacctcccagtatcattgagaaacctgagtcacaggaggtcatacctggaaccagagtg
aagttcaatgtacttgtaatgggcactcccccactgaacatcaagtggttcaaagataag
aaagagatcttatcaggcattgattgctctgttcagaaagatgactcttcaagctttctt
gaactctttttcactaaaccatcggattctggagactacatatgtgaagtaaccaatgat
gttggttcagatacttgccaggcaacactctttgtcaaagaacctccaaaattcacccaa
aaaccagacaaagtttcagtggtgaaacctggccatcttgtagtttttgagtgtcaggta
gctggcactccagagatagacacatattggtttaaagatggcaccgaaataagcccaagt
gacaagtataaaatgagttttgttaactcattggcatgtcttgagatcactggttctgat
gtcaaggacagtggtgtatattactgtgaggcacgaaacgatgcaggcagtgagagctgt
agtatggagctgaaagtgaaagagccacctgttattgtgaagccgttcactcctgcagag
gttgtgaaaggctcgaatgcttactttgagtgtcaaatcaaaggctccgctccatttgag
attacttggcaaaaggattccaaggaaataaaagcaagcactaaacatttattctatcag
aagaatgcttcaataatagttcttgacatacataagtgtgatgacttggatgttggggaa
tatcagtgcattgtttcaaatgaagtgggcagttgttcatgtagaacaacactacatata
aaagaaccaccatcttttgtagagaagatccaaaatgttgccacagtgttgggagatgta
gctgagtttaagtgtattgtgaggggatcacctcctctgattattcaatggcaaaaagat
gagacctggatcttggaagactctaaaataatgaggacatttgatgataatgttgctacc
ttaaaaatccctgtgtgtgatcctagccacagtggaagatacacctgccaggcaatgaat
gaagcagggcaggaaaagtgttttgccacccttttggtgcaagagcctccccagattatt
gaaaagccagaaattattaatgtcactgctggagatccagtcagttttgagtgtaaggta
aaaggcactccagaactgaaagtgaaatggactaaagatggcaaggaggtgatgccatcc
agacaatgcagcctcagctttgtcaataatgtcagcaatattaaaattcagtctgtgcag
ttagatgatgggggaatatatctttttgagatttccaatcacatcagtgtctgccagtgc
accgtgactttgaatgtcctagaacaaataattcctccggccttcatcaaatctctcagt
gatatggaggagattctggggtcctctgtgaaaattggatgcagtatatctggctctcac
ccaatctctgtagagtggttaaaagatggaactaaattgtcaggtagaaccaagcataaa
ctgattcaggatgataacagcgtgtctttggagattgagcgactagagaaggctgacact
ggaacctactcttgcaaacttacaaacagagcaggcagttgtgaatgcagtggaacactg
agggtgaaagcgcccccgagctttgtggtggtgccagagccccaggctgtcatacccaat
accactgttcgctttaagggtacttttacgggcacacctcccttcacagtgaaatggttc
agggaagacactgaactgatcactggaccatcctgctttattggccttgaagggctttca
tgcttcatagatctttatgcagttggactttcaaatactgggacttactcttgccaagtt
agcaatgatgctggttcagtgaaatgtactacaagcttactggtgaaagaaccccctgag
tttgtacagaaactgccagcaacaaagtttacaaagatgggagagcctcttcgtcttgag
tgcaaagttactggcactcctcctttaaaaattagctggtacaaaaatgacaccatggtc
agcgacactcccaatatgaagatgacgtttgatgacgtgatggcagtgcttgagattttc
agcacaagtcatgatgatgaaggagtgtacacatgtgaagcccagaatgatgcaggaatt
aagagctgcagcaccactctctcagtcaaagaaccaccgactttccacaaagcacccaca
cctcctgagggattgaagggaaaagatgcaagtcttagctgtgagttaaagggaacagtg
ccctttgagataacctggtttaaagacaaaaagcaactgaaagagagtagaaagtacaag
tttgtatctgaaggacactcagcaactttgcacatccttggactggaagcatcagatgct
ggggagtatgaatgcaaagcctcaaacaatgttggaagtgacacctgctcagcgatggtg
aaacttagagagccaccaggttttgtcaagaaactgtccaatactacagcagtatctgga
gaggaagtgactctggtagccactgtcaaaggctctgagccaattgatgtgtcttgggtt
caagataaggatcatattctcagagacagtgacaacatgaaaattgcatttgtgaataac
caggtcactcttacagtctttaaagctgattctaccactgctgggaagtatacttgccgg
cttaaaaatgatgctggtgtggccgaatgcatggcaaaccttacagtcctagatcctgct
gccattttggataagacagagtctgtcagtgtcacagcaggtgatgcagcaactttagaa
tgcacggttactggaacccctgagctcaaacctaaatggatcaaagatggtgttgagctg
tcttctagtaggaaacataacatcaccttttccaacaagatatccagtcttaaggtgttg
tcagcagagaaaggtgatactggagagtacacctttgagatcaagaatgaggttggcagt
gatagctgcaaaatgaacctcactgtctttgataaaattatccctcccacattctcacga
aaaatgaaagacactcaaagtattgttggaaaaccagttgaaatggactgtaaggtctca
ggttctgcacccctcaccattgcttggtatcatgatggggtggagatcatgagtgggcca
acttatcagattagctttgctgagaacacctgtacacttaaaatgcccattttgaaattg
tcagactctggttcatacaagtgcatagcagcgaacagcgccggcactgctgagactact
gcctcgcttgttgttaaagaacctccatcttttgtgatgccacctcagccagtggaagca
ctcccaggttcacatgtaaaattcagtgccactgtgaaaggaagtgccccattaaaggta
aaatggttcaaaggcactaaggagattgttcctggcagagcatgtgaaattgccttaaga
ggagatgtagccacaatggaactcttaaatatcgacatatctcattctggagaatatacg
tgccagattactaatgatgtagggaaggaaagttgccctgtcactctctttgtgaaagag
gctgcacgttttgtcaagaagctaaagaatctctcagttgaaattggaaagtcaatgata
cttgagtgcacatacactggaagcccaaagattcttgtaaaatggcagaaggatgaccaa
gaaatcttctcctcttacaaatataatatcacaaccactgagacgtcctgcatcttagag
tgtctaaacagtgataaagagacagcaggaaaatacacttgtgaggttaccaatgatgct
ggacatgatacctgtgatgcaacagtgtccatattaggttagttttatttcctngagagc
ttggagccaatggaggtgactgctggtgatgcagtctgtctgaaatgccagattgggggt
actcctgtgatcaatgtggcttggttcaaaggagatggcaaagtccgatcttctccatcc
tgtagaattgagtattccaaaggcactgcttgcttgaaattaactaaagttttaaaagcc
gacacaggggaatatatttgtaaggcagaaaacagcattggagctgcatcttctagctgc
tatttaactgttcaagaggccaaaacaccaccttctttccccaagaaaattactagcatt
cagcaaatcgaaggacatagtgtccagtttgaatgtcgtgtttcaggatcttctcctatt
gagatttcatggcttaaagatggtgaacctctgaggagtgactcagagtacacaatgact
tttgatgataactctgctgtcctaaaacttgccaagggtgaaatgaaacactctggagaa
tacacttgtgttgcaacaaatagtgttggaaccgcctcttgcagagccaagctgacactt
caagagccaagatacccacctgtatttgacagaaagcctttgcctgtggaagtttcagtt
ggagatactgtggaactggaatgccacatgactggatcattgccaataaaagttacttgg
tccaaagatcacaaagatatccgcacagggggcaattataagatatcctgtgtggaaaat
accccacatctgactattctgaaagttgataaggctgactctggccgctattcttgccat
gctagtaatgatgtggggaaggactcttgttcaacagaggttactgtgaaagagcgcaaa
gttccaccaagcttcaccaaaaagccttcaggaaccattgaagagaccgagggcaagtta
gtgaagattgaggcacgtgttgctggatcacagcccatgacggttaactggtacaaagat
ggcacagaaatcttcagctctgacagttacgacataaccttcaagaccaatgtgcctgtg
ctctgtataaagaattccagagtctcacatagtggtacttacacatgcatggtcaataat
gatgctggctctgcttcttgcgaggcttcagtccacattatagagcaaaaagtacctcca
agatttgacttgcctcttaaacctgtgacggtgaatttgggtgatacactctcccttagt
tgccacgtatgtggttctcctcctattaaaattcagtggatgaaggatagaagggaactg
atgacctctgccagtacgaacatcacatttgtagatggcaatgccatactagagataggc
aatgtctctaaagcagatgctggagattatctctgtaaggcaaccaatgaagctggtagt
gagttctgcaagtctagagtcactatcaaagagaagccaggagtccctgcacccactccc
acagctcctgcagctgctgagccagttaagaaactggacaacttgttcttcattgagcaa
cccaagagtgtccgtatcactgagaagggccttgcaacattcattgctaaggttggtggt
gatcccattcccaacgtgaaatggatgaagggcaaatggaggcagatgactcacggtggc
cgcgtaactcttgatcagaaaggacaagaggccaagatggagatcagagaagtgaccaaa
tctgactctggccagtatagatgtgtagcatctaacaaacatggagaaattgagtgtagc
actaacctcactgttgatttgaagaaggagattgcacctgaaacagtgacactgaagaaa
accccttcaaaacagaaaagccctaaagaggacaaggatattgacattattgaactgctc
agaaatgtggatcccaaagagtatgagaaatatgctcgcatgtacggtatcacagactac
cgtggtcttctccaagccattgagttcctgaagaaagagaaagaagaacaatatggaaga
ccggaagtggatcgtacaggtcgtgattcagaagaggatttgtccaaacttgtggctgat
ttgcagaagagaatggaacagactgagcctgtaacactgattaatgacatcacggaccag
accacagttgccaataaggaggctgtgtttgaatgtgaaatcaaaatcaactacccagaa
attacactatcctggtacaaagggacccagaaactcgacacaagtgataaatatgaaatc
aacattgttggtgaccaccatatattgaagatcaagaactgccagtcccgagatgaagga
agctatcgaattgtatgtggaccccatatctccagtgccaaactaacagtgttggaaggt
gaagtggagcagcacatggaagatgtagctggtaaggaaggcgagacctgtgcattgaca
tgccagttctccatacctaatgcaaagacgcagtggtttagaaatggaaagcttttagaa
cctcatggcagatacacattcactgtggccaattacactcagaagctctcaatcaaagat
gttaggcctgaagaccaaggagaatatacctgcaaatataaaaaccttgaaacaactgca
catctttgggtcgaagcggagcaaatacattttactaaacgcatccagaacattgtggtc
cgggaacgccagtccgctacttttgaatgcgaagtgtctttcgacaatgcagtcgtaaca
tggtacaaagacacatgggagctcaaagagagcccaaagtatacattcagaagtgaaggg
cgacgacactttatgatcatccgcaatgtaacctctgatgatgaaggcgtatattcagtg
attgtcagattggagccccgaggtgaagcaaaaagtacagcagagctttacttgtcaggg
aaagaaattgatttaggaagggtgccttatgaaatccccgattcatcaatacaagtccct
gaagcaccatctgcatttaccattgaagctgaatcctctgctgaatactatcattatgaa
gaaaaaatggaagtacaagagtatgagatcaggagagaagaaaaggtagtagaggaaatc
tctgtggcagcactaagaattcctgtggaagagatgattgagagaaaagcacttggaatg
agagaggaagttccagccaaagttcctgaagctgtaatggaatcagaggagacacctaaa
ccggtagaggagaaggaattaataccacctaaagaagccaagaaatatgtggaggaaata
atcataccagtaaaggtggaagaaccaaaagaacgtcccacaccagaagaacgtgaagag
gtacctactcctcagccaactccagtcactcctattaaagttccagaatctgtggttcca
gagcctaaaccacgggtgccaccacctaaacctgcatcagtagctgaacccaaaccagag
gccaaacctaagcctactgcagaagccaagccagaaccacagcctgaactgaagcctata
cctccacctgaagttcctgtggaggccatgaaacctaaaactattcaaccagagccacca
aaggcagtaccaaccaaaccagaaccagaacaggccattgtggctcctaaggaagtaact
ccactaaaagttcctgtggaggccaagaaagctaaactgactgaaccagagccaccaagg
gcagttccaagcaaaccagaacaggtcattgcggttcctaaggaagtaactcctcaaaaa
gttcccatggaggctaagaaacttaaaccagctgaaccagagccaccaagggcagtacca
agcaaaccagtaccagaacaagtcattgtggttcctaaggaagctccacaaaaagttcct
gtggaggccaggaaagctaaaccgactgaaccagagctaccaaaggcagtaccaaccaaa
ccagaaccagaacaagtcattttggttcctaaggaagtaacccctccaaaagtacaagaa
ccttccaagaagccagaggttctgaaaaagacagatgctcttcctactaaaattgatgac
aaacaaactgaagttcgcaagaagaaaaaggaagatgaaccttctcttaaaaaagaagaa
agtcctgcacctcaaaaactaaagcctgaatttttatcagttgatcccaaagagctcatg
ctggatgccaggctagtatttaaacctgaggtaaaacctgtgcttataactgaggtcaaa
ccagaacctaaacctgagatcaaacctgtccctaaacctgaggtcaaggctgaacctaaa
cctgaggtcaaaccagaacctaaacctgaggtcaaaccagaacctaaacctgagatcaaa
cctgtccctaaacctgaggtcaaggctgaacctaaacctgaggtcaaaccagtgcctaaa
cctgaggtcaaagctgaacttaaatttgaggttaagcctgaacctaaacctgaggtcaaa
cctgaacctaaacctgaggttatgcctgtgcttaaacctgaggttaaacctgaaattaaa
cttgaggtcaagcctgagcgaaagttggtcaagtctgaacctaaacctgaggttaaacct
gagcctaaacctgaggttaagcctgtgcctaaacctgaagttaagcctatgcttaaacct
gaacctaaacttgaggtcaagcctgagtgtacattggtcaagcctgaatctaaacatgaa
ccagaactgaaacctgcatcaaggaaaactgagtcacctccagcaaaagctcatgtggag
gaggagacaccaaaaccaactcgaccagaaccaccaagggccatgccaacagaaccagaa
aaggtctcagttgtacctaaagaagtagcccctccaaaagtttatctggaacctacagaa
gaagagttggcaagaaaacttgttgcaagttttgtcccaccaaaggtggatgaccaagct
gaagtgcctgaagcagagaagaagcctctcccagaaaaggcacctgagaaaaaaaaggaa
gttgctcccaaagttgaaaagaaaccatctccagtacctgcagagaaaatctctccaatt
gaagttgaaagaaaaaaagaactaccagagcctgcagtaaagccacgagaaaaggaaatt
tctcctgttgaagatgctgaaaagggacctgttgcagcacctgcacctgtaaagaaaggg
aaacctcttagtaaggaggaagaaaaactagaaatgccaactctaaagccaactaaaagg
atatccaaagacaaggaggaagaacaagaaatgttgaaactgaagaaagttcataagcct
ccaccagaaaagcatgaagaaagcgaaaaggtctgtgctgaagcagtcacaggggtttta
attactgactcttatgaagctgaaatgtactttgagaaatatgaacgaatcaagaaacct
gaagaaataagacctgaaaaggacaaaaaggagccagttaaacatgctcaagaaccagag
aagatgaaaccaaaggaagacaaggaagaaaagcctgatttgaagaaaacagtcaagatt
ccaaaacagggcacagctgatgagccagacctggctctgaagaaagtaaagaaattacca
tctgaaacaaaagaaccagaaacagtgaagttaaaaccttttgaaaaacctagaaaacca
gagcttgaaccagaaaaagacactaaaaaggaatcaaaagagagagaacctatatctttt
ggaagggagagagaacctgttagttttgagaaaggtgaacgatctcggaaagaagatatt
ccgaaagagccagaggttcctcccaaaatagtggagccttctaaactccaggaaaagaaa
ccagatgaggctgtatgtagacctgttgataaagataaaaaaggtgaaatgctggacaca
cctgatacaccatcatggaaaggcaagagaatcccccaaaaagatgaggagcctgagaag
gttcagctaaagccatttgcaaaaaagctttcagctggctcacctgcagaaaaggagact
cctgagcccaaggaacgaaagcctataaaaatatcaccaccaagtaaactgcccaaggat
ggaattataaaagaaccacaagctcctgtgaaagaagatgaaaagcataaaatacctgac
aaagagtttgataagagacccgatcatgtacctcaagaaaaggaaaagaaggagattccc
aaaaaaataactcctgtgaaaaaggatgtgactccaaagcaggaagagaagaagcctcta
ataaccaaaaaaggtagtttacccaaggagcctgaaaagaaagaagaaattgtacttaaa
cctgttgaactggcaaaaaagggtttagaacccaaaaagactccttcacccaaggttgac
caaggaaaaccaattgaattaactcctgtggctcctgtggagaggaaaccaagtggaact
gtggctgtggctaagaaaccactccctgaaaaggtatcgcccaaagacttaattgaagct
gttaccctgaaaaaggtacctaagaaagtttcacctaaggaggaaaagaccaaagaaact
cttccaataaaaggaaaaggagagactcctgtaattaaagagctgtcccctacagctgta
gagatgagaaaaatctcaacccaaatggaagaagaagtatttgaagaagagatgattgag
gttggagatgaggaagaagaggagacctggggatgggagttggctcctcgtgatagttat
ggctctgaagacttagagtatttggaagaagatgcacttgagactccagggatgccagga
ggtagacgagagggaaaaccaaaagaggagttgggtagagggagaggtttgacaccaagg
caaactccctcacctggtgaagttggacgtagaaagggtctaaaacccggcgcgggtggt
gagaaacctccaggagaggcatttggtttccagctcaaggctgtccctctgaagtttgtg
aaggagcttaaagacatagtgctgctggaggctgagtcaattggatcatctgctgtattt
gagtgccagatttcaccttctactgccgttacatcatggatgaaagatgacagcaacctg
agagagagtccaaagcacaagtttacctctgatggcaaagaccgtaaactggcaattatt
gatgtccagctctcagacacaggagaatacacatgtgtagccaagcttggaaataaagag
aagacctctactgccaaacttattgttgaagagttgcctgtgcgattcactaagaccctc
gaggaggaagtttctgtgataaagggacaaccaatgtatttgacctgtgagttaagcaaa
gacagggatgtggtctggaaaaaggatggaaagccactctcagatattcctggcaagata
gccatcaatgtaattggtctgcagcgtgcactgacgattcaagactccaatgatcttgat
gctgctgtttacacatgtgaatgcgagaacctccaaacccagtcaaatgtcaaaattacg
gaaatcattagagactggttggtgagaccactgagagaccagcatgtgaaaccaaaggcc
acagctaccttcaagtgtgagctcttcaaagacactcccaactggaagtggttcaaagga
gatgaagaaattcctaccgaacccacagataagactgaggttaaaaaagaaggaaaagaa
atcacattgagcataaagaatgctcagccaaatgatgctgatgagtttgctattgaggtg
gaaggtcggagatacccagcaaaactcacgcttggagagcgtgaagctgagattctgaaa
cctctggctagtgtggaagtggtggagaaagaagaggccagctttgatacagaaatatca
gaggatgatgtgcctggggaatggaaacttaaaggacaggttcttacaagatcaccgact
tgtgatattagggtagatggaaacaaacggttccttactctgaaaaatgttcagcttgat
caggctggagaagttacttaccaagccctgaatgccatcactagtgcaatgctaacagtc
aaagaaattgaaatggacttcacagtcccactgaaggacgttacagttcctgaaaagaaa
caggcaaagtttgagtgcagcatcactaaggatgtgcctaaagtgttgtggtatagagga
tctgatattgtaatatcagaccagaaatacgatatcattaaagatggaaagaaacatatg
ttggtcataaacctgtgtgaatttgaagatgagggcgattactctatagaggttttgggt
aaaacttcaacagctaaactgacagtggagggtatgaggctgaagtttatttcgccaatg
tcggatcaaactgtgaaggaaggtaaaacagctttgtttgaggttgagctgtctcatgag
aatgtgccagtgacgtggtacaaaaatgaaacaaaactgcatacgagcagaacagtgctt
acccatgttgatggaaagagacatatattagaactcaaggaggtcactctagatgatatt
tgccaaataaaggcagaggcaaaaggaatatcaactacagcaaacctgacggtgctagag
ggagatgcctactttactgttaaattgcaagactacactgcagtcgaaaaagatgaggtc
attcttgactgtgagttgagcaaagatgttcctgtgaagtggttccataatgagatggaa
attaagtcctctaagatggtttccatgagggcagaaggtagaaggagaatcctaaccatt
aagaaagtggcagacaaagacaagggccagtatgtctgtgactgtggaacagacaaaact
ttggctaccatgaatattgaagctcgcgacatcaaggttgttcgacccatgtatggtgtt
gaactttttgatggtgagactgcacgttttgaagtggaactgtcagaggatgatgtccat
ggtcagtggaaacttaaaggagaagttcttgttcagtcacaggatgtcgaaatcattgag
gatggatctaaacacattttaacactgtacaactgcaaagttccccagactggcgaggtt
tcattccagggtgccaatgcaaagtgttctgcaaatctgaaagtgaaagaactcccaatt
accttcctaacacctctgagtgatgtgcaagtgtatgagaaagacgaagcaaggtttgag
tgtgaaatatctcgagaaccaaagaccttccgttggctaaagggaagccaggaattgaag
gctgatgataaatttgaaatcctctcagaggttaaaaggcacactctagttgtcaaatct
gcagcctatgaagatgaggccaaatatatgtttgaggctgaagacaagagaacctctggc
aaactcatcattcaaggcattcgtcttgagtttgtcagacccatcaaggatgttactgtg
aaggagcgtgagacagcagagttccgcattgaactgtcacatgagaaagttcaggtcacg
tggtacaaaaatgatgtgcgtctgcacccgagtaaagtggtgcacatgtcagaggatggc
aagatccatactctgtccttcaaggaagtgtccattgatgatacctctttaattaaagcc
gaggcccttgggaaaagctgcgaggccatgcttactgttcttgagggagaagcttacttt
acaaccaagcttcaggattatacagccgttgagaaggatgaggtggtgctgatgtgtgaa
ctgagcaagcccactgctgaggtaaaatggttcaaagatggcaaagagatcactccatca
aagaatatcctcatcaaggctgatgggaagaaacgaattctaatagttaagcgtgctgac
aagagcaatattggcgagtatgcttgtgactgtggctctgacaaaacaacggcaaagctg
aatattgaggatcgtgacattaaagtggtccgaccactgtatagtgtggaggtcacagag
actgaaactgctcgctttgagactgagatctctgaggaggatgtgcatggcaactggaaa
ctcaaaggagatgctctacaccagtctgcggattgtgagattaaggaagaaggcaccaaa
catatgctcattctctacaatgtgcaaatggacatggctggtggtgtggatttcagtgct
gccaatgctaaatctagtgctcacctcagagttaaagcacgagtaataggccttttgcgg
cctctcaaggatgttacggttacagctggggagactgctacctttgactgcgagctttca
tatgagggcatatctgttgagtggttccttgggggtacaaagctggaaccaagtgacagg
gttgtcacccgagcagaaggcagaaatcacacgctgacccttagagatgtgaagctgact
gaggcaggagagataaaactcactgcaaaggatttccaaactcaggctgagctcattgta
aaagagcctccagtcgagttcaccaagcccctcgaggaccagactgtagaggaggaagct
acagccatactagagtgtgaagtctccaaagaaagtgcagaggtcaagtggttcaaagat
ggacaggaaatccataaaactaagaagtatgagatggttgctgatggtcgccatagaaaa
ctcatcattcaagactgcacacttgatgattcaaggacatatacctgtgacgccctacac
ttcaagacttctgcattcttgaatgttgaacccccacatgttgagttcactaagccactc
catgatgttgaggtcatggagaaagagtctgccaagtttgaatgtgaagtttccagagaa
agtgcaaaggttcgttggttcaaggatggaaatgaaatcagaaagggcaaaaaatatgag
atcatttcgaagggagttcaacgcatcctcatcattagcaaggcagtatttgatgatgag
gcagaatatgaatgtgatgcaaagacctccaggacctctggcatgctgactgttatagag
gaggaggcaagatttacgaagaacttggctaatgttgaaggaactgaaactgacagtatc
aaactgatcagtgaggtctccaagcccagtgcagaggtcacatggtacaagggtgaccag
gaactgcctgagggtggaagatatgagcaaattacagatggcagaagaagaatccttatt
atccagaaccttcgtatggatgatgctggagaataccactgcaaactgcccagctcacaa
accacagggaacctcagaattaatgaacttgctgctgagtttacttccagacctcagagt
caggaggtggttgagggtgaaaaggctcagtttgtgtgctcagtgtccaaagactcctat
gaagtcaaatggctcagaggcaacaaagaactccaaacagatgacaaatatgaaattatt
tctgatggcaagagacgagtccttgtggttaagaactgtgaccacaatgatgagggacca
ttcttggctctcattggatccacgagagcgtctgctgatctgacagtgatagagaaactc
aggattatcactcccttgaaggacacaaaggcaagtgaaggacaagagattgtcctcaac
tgtgaggtgaacacagaagcagccaaggccaagtggttgaagaacaatgacacaatgttt
gagagcagcaaattcatcatgggccagaaatataatgtgttctctctacggattaaaaat
gctgataaatcagatgcagctgcttacaccgttacactgaccaatcagcgtggtgaatat
gtcagcagttcagccaacattactgtacaagaggaagatctgaggatcattgttcccctt
gatgacattgacacgcaagagaagaagattgttagcttctcatgcaaagtgaacaagcta
aatgtgaccgtgcaatggatgaaggctgatcaggagatcaccttaaacaagcgtgttgtg
taccgtgttgataaggataagcacactttgaccattaaggactgcagtcttgcagatgag
ggtgaatacactgttattgctggtgctgacaagtcaacagcagagttgatcatcagtgaa
gcaccaactgacttcaccacccaactccaagaccagaccatcatcgagttcgaagatgct
gagtttacatgccagctctccaaagagaaagctgacgttaaatggtacagagatggccga
gaaatcagagagggcccaagatatcagtttgagcgtgatggaaacgtatgcacactgcgc
attagagagtgccgactggatgatgagtgtgaatatgcctgtggagtaggcgacaaaaaa
tccagggctcgtctctttgttgaagagattccagtgaagatcatcagaccacccatggat
gtatttgagccaccaggttctgatattgtgtatgaggttgagctcaacaaagatagagtt
gaagttaaatggctaaggaataacatgaccattgtccagggtgacaaataccagatgatg
agtgaaggcaagattcacagactccaggtctgtgagatcaggcctcgtgaccagggtgaa
tacagggttattgccaaggacaaggatgcaagagccaagcttgagcttgcagctgtgcca
acgatcaagactttggatcaggatttggtgacagatgctggaactccattgaccatgtca
gttccctttaatgcatacccacaagctgaggctgaatggttctttgatagcatcagcctg
ccaaaggagaatgttcatgtctctcctgataagacagagtacaggatgaaggaccccaaa
aaatcagaagagggccattacaaaatcattataaagaataagcatggacagggagaggct
ttcattaatctgaaagttattgatgttcctgggccagtcaagaatctaagagttattgac
acagcagacggtgaggtcagcctggcatgggatgaacctcagaatgacggtggaagcaag
atcctgggttacgtagtagagagacgtgatgtcaaacgcaagacttggactctcgccact
gacagggctgacagtacagaatacactgtcattgggttgcagaaggactctatgtatttc
ttccgggtttgtgcacgcaatagagttggttgtggaccaaatgttgagacagatgaagct
gtgttagccaagaataagtttgatgtacctgatgcaccacaaaatgtcacagttggaaat
gtcagcaagtttggtgccacagtctcctggaatccacctctgtttgatggtggagctgaa
atcacctcatacatcatcgagctccgtgacagaacatctgtgcagtggtctccagtcatg
gtgactaaaccacaggaccgtaaagcagtagtcaatgatgttattgagaacaaggaatat
atcttccgtgttcgagcagaaaacaaggctggccctggcaaaccaagtgctgctacaaac
ccagttaaaattatggacccaatagagaggccaagcccacccctgaatctgacacactct
gaacagaccaaggagggctgtctgttgagatgggagcctcctcttagaaatggtggtagc
ataatcactggctacattattgagaggtgtgaggaagattcagacaagtggatgagatgt
aatgccaggctttgcccagacctactctacagggtttctggacttaaatgtggaaagaag
tacaaataccaagtcattgctgaaaatgcagctggccagtctgacccctccaatattgtt
ggacctgagctggcagatgacccacactttgcacctacactcgacctgagtgccttcaag
gatggcctggaggtcattgttcctcagcctcttattatccgggtcccaatcactggatac
ccaacacctactgctaaatggaccattggtgacacagagctcaccgctggtgaccgtgtt
tccatggtcacaaagcccaccttcaccgagttagtcattaccccaagtgtgcgtccagac
aaaggcagatattttctgacactggagaatgatgtaagcagtgtctctggggagattgag
gtcaatgttatcgcatcaccaagtgcacccaaggactttaaggttgcagaggtaaccaga
aatcatgtccatcttatgtgggaagcaccggaccatgatggaggcagcccgattactgga
tatcaagtggagaagcgtgatgtctcaagaaagacctgggtcaaggtcattgctggctta
caagaccaggagtacactatcacagatgttgtcgagggaaaggagtacttgtttagagtt
attgcttgcaacaagtgtggcccaggagagcccgcatacattgatgatccagtaaatgtg
tcttcaccagctactgttccagatccaccagagaatcttaaatggagagataagactgcc
aacacaatcttcctgtcatgggagcctccaaagtgggatggtggtgctccaattaaaggt
tacactgttgacaaatgccagcgtggcactgacaaatgggagccatgtggtgagccattg
ccagacctcaagtttgaggtaactggtctgacagagggtcaatggtatgcatatcgtgtg
agggccttgaatagactgggctcgggtagacctagcaaggcaactgatgagatcctggct
gttgatcctaaagagcctccagaaattcacttggatgcaaaactactggctggcttaact
gcaaaggctggcacaaagattgaactccctgctgatatcacaggcaaaccagagcctaag
atcaaatggaccaaggctgatcttatcctgaaggaagatgatagaatctctattgttacc
aagccaggccactccacagtgtacattgctaagacaacaagggaagactcagcaacatac
attgttgaggcagtcaacagcagtggccgtgccacagcaactgttgatgtcaacatccta
gataagcctggacctccagctgcttttgatatctctgaaattaccagtcagtcctgccta
ttatcatggaatccaccaagagatgatggtggttcaagagtgacaaactacattgttgaa
aggagagctacagatagtgagatatggtacaagctgtcctccactgtgaagcaaaccaac
tacaaagccaccaaactcattaatttcaaagaatatattttcagagtctatgctgagaat
caatttggcattggtttgccagctgagcatgcaccaataactgccaaatatatctttgat
tcacctggacctccgtacaaagtcacagcatcagatattgcaaaggatgctgtaactttg
tcttggtatgaacccgatgatgatggtggaagtcctgtcacaggttactgggttgaaaga
tttgagccagaagctgacaaatggataagatgcaacaaacaaccgatcagtgacacaacc
ttcagggtgaaaggtttgcccacaaggaagaagtataagttccgtgtcttggctgagaat
cttgctggacctggaaaaccaagcaaggagactgaccagatcttgatcaaggatccaatt
gatcctccatggcctcctggcaagcctagtgttaaggatgttgccaagacatctgctttc
ctgcagtggacaaagcctgagcatgatggtggtgccaagattgtgtcctatattgttgag
ctcctaaagagtggaactgttgagtgggtccgagtggtagatggtattccttctcttgag
tatttcttgaagggactgatggagaagcaggaatattccttccgtgtcagagctgtgaat
gcagcaggcgagagtgaacctagtgagcctagcgatcctgtgctgtgcaaggaaagactc
aatcctccatcacccccaagatggctagaggtggtaaatatttcccggagtggtgctgaa
ctgaagtggacagctcctgaacgagatggcggttctcccatcaccaactacattgttgaa
aagagagacgtcaagcgcaagggctggcaggcagttgacaccaccgtgaaagaactgaca
tacactgtcactccactaaatgaaggctccctctatgtcttccgtgtggcagcagagaat
gttgttgggcctagtgaatactgtgaacttcttgactctgttctggcaaaggatacattc
actactcctggacctccatatgctctgactgtcacaggggtttcaaagacccatgttgac
ctaaaatgggaggcacctaagaatgatggtggcagacctattttgaggtatgtcattgag
aagaaagagaaacttggaactcgatgggtgaaatctgcaaagacatcaggccctgactgc
aagtacagggtaactgatgtcattgaaggaactgaggtgcagttccaggtccttgctgag
aatgaggctggagttggtcatccaagtgaacccacagacattgtggtaattgaggaccca
acaggaccaccatctcctcctcaggatctccatgtcactgaggcaaacagagaccatatc
tctattgcctggaaagccccagaaaggaacggaggaagcccagtcattggctaccacatt
gagctctgtgaggctggaacagagaaatggatgagagttaactcacgcccagttaaagag
ctgaaatacagagctggggaggatgaaggcattcttcctgagaagcagtacattttcaga
gtccgtgctgttaattctattggtgctagtgatccctctgagatctctgagagtgtttac
gccaaagactcagactgcaaccctacaattgaattccaaacccaggacctcgttgttgtg
gagggtgacaaaatgcacctcccaattccattcaaggctgtaccatcaccaaagatcaca
tggcacaaagatggcaaggagatgaaggctgatgacaggatctcattcagatcagattac
atttcctgccacctggaaattccaagctgcgtgcatgctgatgctgggcagtacaaagtt
accctggagaacagccttggagcaactagtgggacaattaacgttaaagttattggtcta
cctggaccatgtaaggaaattgttgctagtgatgtcactaagaactcctgcaaagtgtca
tgggaacctccagactatgatggtggctcccctgttcttcattacatcttgcagcgcaga
gaggcaggcaggagaacatatgtcaatgtcatgtctggagagaacaaaatcagttggcct
gtcaaggacctgatccaaaatggagagtattacttccgtgtcagagctgtgaataagatt
ggtggtggagagttcattgagctacgcaatcctgtgattgctgaggaccaaaagcatcca
cctgatccacctgttgatgtggaaacgcacaacccctcttctgagtctgtgaccctcact
tggaagccacccatgtatgatggtggatgcaagatcatgggttacattctggagaaggca
atgaaaggtcaagagaagtttgagagatgcaatgatttccttgtgccagtattgtcctac
acagttaaaggcttgaaacaaggaaaagaatatcagttccgtgtgcgtgcagagaacgca
gcaggcataagtgatccttcacggagcactcctatgatcaaagccactgatgcagttgac
cgtcccaaggtgttcctcagtggtagcctgcaatcaggcttaagtgtcaggaaaggtgaa
gagattcgattgactgcctacatctccggatttccatacccagaaataacatggacaaga
aacaattcaactattaggccagaagctttgaagaagagaccagaaaggcctattaggaag
aaaaaagaaaaggagccagagaaggaagaggaaaagaaacaagaggaaattaaagaagac
gacaaggagaaaaaggagaaagaaaaggaggtggaggaacctgaggagccagaggaagaa
taccacccatctctgaatgagcgtcttaccattgataacattagggagggtgaatcctta
atttgtgtgaaagatgttatcagaggtgatcatggtgtatttactatcaaggtggagaat
gatcatggtattgcctctgcaagctgtgtggttaacgttcttgatacacctgggccccct
gtgaatttaaaatttgaggaagtcaggaaggattcactcctctgcaagtgggatcctcct
ctagatgatggtggcagtgagatccttaattacatactggagagaaaagacaactccaag
gttgagatgggatgggttactgttacaacaaccctcagagcctgcaaatacccagtaaca
aaactcattgaaggaaaggaatacatattccgtgttactgcagagaacagatttggcccg
ggaagaccttgtatctccaaacccgtcattgccaagaatccattcgatcctccagaggct
cctgagaagcctgaaattgtggacatcacatccaatagcatggttgtcacttggaaagaa
cccaaggacaatggttgccctattcaaggatactgggtggagaaacgagaaattaatagt
acacattggacaagagttaaccgcagcatctttaataaactggaactaaatgtagaaggc
ctcttagaaggcttgacatacattttcagggtctgtgcagagaacatggctggatgtgga
aagttcagtccaccatctgagccgaagacagcacaggctccaatcttgccaccgggtcca
ccaattgcacgtgttgctgacaccacagaccattcaataatagttgaatgggaccctcct
gtagataatggtggttcagacatttttggttaccatgtggacaagttattggctggcacc
aaagaatggacccgagccacagaaagaccacaaaagagtcttacattcactgtgtatggt
gtcagagaaggtgcgaagtacactactcgcgttatggcagtcaactgtgcgggtgaaggt
gctcctggcattactgaaaccgtcattgtgaagaatcctgccgtgatacctgtaattgaa
cttgatgtcagtgtgaagggtggttttgttgtaagagctggagacacactgaggatccct
gcaaatgtgactggtagacctaaaccatcaatttcatggatggtaaatgatcgtgccctt
gataagaagcgtgtagaaatagaagaggttggacaatctaacacccttatcatcaagaat
gcacagagaggtgatagtggcagataccagatcactgcagcaaacccaagtgctattaaa
tctgcatggaccacagctgaagttgtggatgttcctggacctgtccttgaactcaagcct
gttgtagtcactagaaagttgatgatgcttaactggtctgaccctgatgatgatggtggc
agtgatctgactggctttattattgaacgaaaagaccctaaaagtcacacttttagacag
cccattgaaacagttgcatcgaagtgtgaaattgggggtattgtcgaaggacatgagtac
attttccgagttgtggccaaaaacaagtatggctgtggacctcctgttgaccttggacct
atccttgcagtagatcctcaagctccaccaacttcccctgagaaattccactacactgaa
agaactaagtcttccattacccttgtgtggaagccacctcgcaatgatggtggcagtcca
gtccttggctatgtggttgagaagaagagacaagatcaacctgctttccagcgtgtcaac
ccagagttgtgcactgacctgacaatgactgtggaaaatctagatgaactgcacatgtat
gagttccgtgcaaaagctgttaacagcattggcgaaagtgatccttctataccgatgaat
gttgtgattcaggatgatgaagttcctccacatttgcacatgctgaaacacttcaaagag
gatataatcagagtaaggaagaatgagccagttgagatccccgttgagatcacaggcctc
ccaataccaaaggttgaatggctgaaggatgatgttcttattcccaaatccacagaaaga
gtcctgatagagaccaaagagattgacagactcacagaacacacaaaactcactatccct
gctgttgcaaggctagacaagggaacctatactataactgcttcaaattgcatgggcacg
gtcagccatcatatcacattggaagtactggatcgaccaacaccaccaagaaacgttgct
ctttcaaatatccgagctgagtcttgctatctgacctgggatccaccactggatattggt
ggcagtatgctaaccaactacatcattgagaagaaatgtcttgatgtaaaggatgctgaa
aaagctgaatgggtcctggttactaataccatcatagacagaaaatatggggtacgggaa
cttgaaacaggtggcagatatcagttcagagtcaaagctgagaataagtatggaataagt
gatgcctgtaaaacagaggaagtacatatcaaggatccatttgcactacctggtccacct
gaaaaggtcactatcgcagagcactccacaaatgatatgttggtgacatgggaaccaccc
agggactgtggtggatctatgattattggctattggctagaaaagcgagagaaaggcact
tcttactgggctaaagcaaataaggccatggtgtccaaacgtggcatgaaaggctgggaa
tttcaggtcacacgcctcgctgaaggagttgagtatgaattccgtgcaatggcttgcaat
gctgcaggaattggcccccctagtgctgtctctgagtctgcctttgctattgaacctatg
actccacctagcatgccagcagctcctgaaattgctgacaaaaccaagcgcagtgtcact
ctatcatggatccctcctgccaaagatggtggaagccccatcaaaggttatatcattgag
aaacaggatgaagggacatctgagtggacaagggtcaatgatgcggatagtctacaccct
accactacgttcactgttccaaatcttcaggagctaaaaaagtacagatttagaatcatt
gcagtcaatgatattggagagtctgagccaagtcctagaaccccagaagttctcatggag
gatgttcacactgagccaaagctgtttttggacattggcgctcatgagttagtaaacatc
cctgctggaactccaatcaaaatccctgtaactgttaagggtcgtcccactcccaaggtt
acatgggattttgagggcaaagcaaaaaccgaaattaaagatcgtcttcacaacctgcca
gtggattcacaggtggaatctactgatactacttctgctttaacaattcctgtgagcttg
cggtcccactctggcagatacactgtaactgcaaagaacaagtctggacagaaacatatt
aatatcagagttattgtgcttgatgttcctggaccacctaaggagctcaaaattactgat
attacacgaactacaatgaggcttatctggaaactcccagatactgatggtggagagaga
atcaagagttacttcattgaaaagagagctgtcacagcaaaagcctggacaaaggtgaat
gcgtcctgtgccagtatggcctttgtagtgcctgacctcctcgaaggccaggactacttg
ttccgtgtttgtgcagagaatcgtattggaatgggaccatttactgagaccaccgagcca
gcaagggcaagggatcctatctcaccccctgatcctccagctaaggtgaagatcaatctt
gttaccaagaacactgtgaccctatcatggcaacctccaaaaaataatggtggcgcacca
gtaacacattacattatcgagaggctgagctgggacaccagtggtccgcagaaagagacc
tggaaacagtgcaataagagggatgtggaagaaactaccttcatagttgaagaccttaaa
gagggtggtgaatatgagttccgtgtcaaggcagtgaatgaagctggcccaagcagacct
tctgttactgtgggacccatcatcatcaaggaccagaccttcgctccaaccattgatctt
agagaagccctggagggtgctgaaacatttgacataaacataactgccaggattcagggc
tgcccattcccaacccttgtttggcagaaagctccacttgacaagcctgatgaaaaaact
aatgttcattatgatcagcatatcaataagctggtagctgatgacagatgcactctgcta
attcagcagtccaagagagatgacagtgcagtttatacacttacagctaccaacagtttt
ggcacagcatctaaagatatcagactcaccattttggggcgacctggaccaccagtggga
cctgtcaaaattggggagatttttgcagaaaggattggtctatcatggaagccacccata
gatgatggtggttccaagatcactaactatgttattgagaaacgtgaggagaacaggaag
tcatgggtccatgtctcaaatgatcctaaagaatgtgcttatacagttcaaaggctcacg
gaagggcatgaatatgagttccgcattatggctcagaacaaatatggtgtaggaccacca
ctttacagtgaacctgagaaaacaaggaacttattcactgttccaggccaatgcgataaa
ccaactgtctcagaaatcacacgtgaatctatgactgttgaatgggaggagccagaatat
gatggcggatccccagttactggctattggctggagcgcaaggaaactacatcgaaacgc
tggactaaagtgaaccgtgaccccatcagaatcaggccccttggtgtctctcatgttgtg
actggtctcttggagggagctatctatcagttccgtgttattgccattaatgctgctgga
tgtggacttccaagtcttccatcagaccctgctgtttctagagacccaattactcctcca
ggacctccaataccaaaagtaattgactgcactaagtcaactgtagaacttgaatggatt
cctccaatgaatgatgggggatctaagattacaggatattttgttgaattcaaagaagaa
ggaaaggaagaatgggtgaaggctaaagataaagagattagaggcaccaagtttgttgta
cctggactcaaagagcttggactttacagattcagagtgagagcagtgaatgctgcaggt
gctggtgaacctggtgaagtcactgaagtgattgaggtcaaagaccggacaattgctcct
gaagtggacctagatgcaacagtgaaagagaagattgttgttcacgctggtggagtaata
cgcatccttgcctatgtgtctggcaagcctgcgccagagattacatggaatagagatgat
gctcctttgcccaaagaggctgttgttgaaactactgctatcagttcagctctggtgatc
aagaactgcctaagaaagcatcaaggcatttataccctaacagctaagaatgaaggagga
gaaaggaacaaggcaataattgtggaagtgctagatgttcctggccctgtgggtcagccc
ttctctggtacgaatcttaccaatgattcttgcaagctgacatggtattcccctgaggat
gatggtggctcagccatcaccaactacattatagagaagagagaagctgaccgccgaggc
tggacttcagtgacatacacggtcaccagacataatgctgtggttcagggtctcattgat
ggcaaggcttacttcttcagaattgctgcagaaaatataattggaagaggcccatatact
gagacagcatcagaagtttgcattaaggatccagtttctgtgcctgagcgtccagaggat
ctggtggtaaaagctatcaagaaggattcaatcaccgtagcatggagaccaccaaaatat
gatggcggggcagaggtgacgagttatgttcttgaagttcgtcagcttggaaaggacaac
tatgtccaaattgccagtgacaataagctgatggatcgccagttcactcatgagggtctc
aaagagggcgctagttatgaattccgtgtgagtgctgtgaatcaaattggccagggcaag
ccttccttcagcaccaaaccaattatgtgcaaggtagagcttgaaccaccttcccttgac
ctggaattccatgatacacttttggtacgtgttgggcaaccctgcactctccaaggtcgc
tacggagggaaaccaacaccaacaattaaatggttcaaaaatgatgaggaacttcaggca
aatgaggacattgtgcttactagcactaagaagacactgtgcttgtctattgagaaagct
aagcgtgatcacagtggcaaatacactgtggctgtggagaactcaattggcacatgcaag
cgcatctgcactgttactgttgttgatcgtccccaacctccagagggccctgttgtcttt
gatgaaatctacagggatcatatggtcatttcttggaagcccccactggacgatggtgga
agcgctgtctctaattatattgttgaaaagagagataccaaccgggatctctggatgcct
gtcatatcgtcttgtactagaacaacatgtaaagttcctaaactcattgagggaagggag
tacataattagaatctgtgctcaaaacatccatggcattagtgacccattactgtctgca
gagacaaaagcaaaagatgtcttcaaggtgccagatgctcctcagcaaccagtggtgaaa
gaagtctacaaagacacagctcggatttcatgggaaccacctgctgatggcggaaaacca
atcacaaactacattgttgaaaagagagaaacaatgtcaaacagatgggtccgtgctgga
accgatcgcattttccctaaaacagaatactgggttcctgatcttctcaagggttgtgaa
tatgagttccgtgtgatggcagagaatgtgattggtgttggtgaccctagcccacccaca
aaacctgtcttcgctaaagatcctattgtggttccaagcccacccataaagccaatggca
attgacaagacaaagaactctgtcactctttcttgggagccacccaaggactctggtgga
ggcaaaatctttggctacctccttgagtatcagaaatctggtactgaggaatggctccag
gttaatcagactcctgactcctgccaggaaactacatttaaagttaccagccttgaagat
ggagcactgtataggttcagagtaaaggctgttaataaagctggtgaatctgagcctgca
aatgttccagagcctattcgagcacaagacagacttgagcccccagagttgttgctggag
atgggcatgcctcgcgagattaaagcactggctggaacccatattaaaattgttgctgga
attaagggtatgcctattcctaatgtcacatggaagaaaaatgatgcagatgtgcctcca
agagcagaaattcagaccactggagtaagaaccaagcttgagatgcgttactgtaaccga
agtgattgtggagactacacactgaatgttgaaaatccagcaggatccaagacagcaacg
tgcactgtgcttgttctagacaaacctggaccgattcagcatttgagagtatctgatgtt
agaagtgactctgctcagctgtcctggaaagatcctgaagataatggtggtacacgtatc
acgaactttgtggtggagaaaaaggatattgcttctacacaatgggtgccagtctgttca
acatctaaaaagcgaagccaaactgccaagcacttgatggaaggcacatcatacatgttc
cgtgtagctgctgaaaatcagtttggtagaagtgaatttgttgagacaaccaaacctgtg
aaggcgatgaatccactgtttccacctggtccaccaaaggatctgcatcacgtagacgtt
gacaaaacagaggtgtggctccaatggaactggcctgatcgcacaggaggaagtgacatc
acaggcttcttggttgagtaccaagaggagggtgaaaaagactggattgtcttcaagact
gttagcattcctgaatgccatgtgactggtctagaagagggaaaaacctatagattccgt
gttaaggctgagaatgctattggacttagccgaccagacacaactgtgccagttctttgc
catgagaaacttgtgccacccattgttgaagtggatgcaaaactgattgatggaatcatt
gtgaaggcaggaagtactatcagactacctgcaatcatgagaggcattcccattcccagt
gcaaagtgggtgcttgatggggaagaaattagaagtggaggaaatataaagattgacaca
gacaacttttcaactgttttgaacattgcagactgcacaagaaatcacactggagtgtac
attctcacagtgtctaatcctgcaggaagtaagactgtttctctgaatgtcactgtactg
gatgtcccagctgcacccataggtcctgtgaacatccttgaggtcactccagattcgatg
gtcattgaatggcgtccccccaaagatgacggtggaagtcctgtaatgaattatgttgtt
gaaaagagagagtctaataaggaaacctggggaggtgttagctctggtagtactgccaca
aggctcaagatttctcgtttgcagagtggtgttgaatatgttgtgagaattcgcgcagaa
aacaagatgggaataggtgcacctcttgaaagtgcaccaactgtagctaaacaccaattt
gagccacctggtcatcctggaaaacctgttgcttctgatattgctgaggatgcagtaact
cttgcttggacaatgccattatatgatggtggcagtccgattaatggttacattattgag
cgcagacataagggaggcaaatggatcagagtgaataaaacaccttgcagggacctcaga
tttagagtgcttggactttttgagggtaatgactatgagtttagagtatttgctgaaaat
attgctggcttcagtggaccctcacctatttcagacccagtcaaaccttgcagacctatc
acagttcctggacctccagttaacccaaaagttaaggactatagctgtaattatgcagat
ttagtctggataaaacctacaagagatggaggaagtccaattttgggatatattgtagaa
tgtcagaaagctggtggtgaatgggagaaagtaaatgcagatgatttgattaaacagtgc
acttacagagtcaagggattaactgaaggcacagaatacaggttccgcataagagctgtc
aacatgattggagaaggtgagacaagagaagtgccagaatcagttattgctcaagatatc
cttatccccccagagattgagatggacatcacatgtcgcacacatttgactgtccgtgta
ggacataacattaatattactggatatgtaagggcaagacctgatccagtgattacttgg
tccaaaggtgagacagttttggaaagagataaacggacaactttgacaaataactttcct
gtagtacatatgcgcatcaaagaagcaaccagagcagatcatggaaagtatactcttaag
gctgtgaatgacagtggagaagcctcagtcaccatcactgtaaatgtactggatagacct
ggacactgcaggaatcttacattgacatatgtgaccaaaaatgcatgcatggtgaattgg
gatgctccagaagacaatggaggcactgagattacaaactatattgttgagtgtcgtgag
ccaagtgttagaacatggtcaatgatctcctctgactgcacaaatcgcaaggtaaaggca
aaactactggagaatcatgaatatttcttcagagtgactgcagagaacaaatgtggtcct
ggaccagcaacagaaaccaagacacctatacttgcaatcgatccacttcagaagcctggt
gagccagagaagttccatgtcgcggattttggcaagaactttgtgttcctgaaatggcaa
agaccagattatgatggtggcaaccctaatctggggtacatattagaaaggaaaatcaag
gatgctgaaaaatgggaaagcttacatgatggtgtactcaaagacacattctttatggca
gataagtgtactgagaaccagacctatcagtttagagttaagactacaaatgatgccaga
gaaagcaactgggtgatgacatctgaagttcttgtcaaagaagaaatccagaaaccagtc
cttgacctcaaatttgctggtactgttgtggtaaaagctggtgaatcagtcagacttgag
gcagcactgagaggaaagccacaacctgaggtcaaatgggtgaaagacaaagccacagga
cataaccccagaatcagcattgatactggagctgactactcaaaattcctcatgactaaa
gccaaacgctctgatactggaaaatatattatcactgccactaacctagctgggagcttt
actgcttatgcaactttaagtgttctggacataccagggcctgtaagagatgtcagagtt
tctggcatgtccactgacaaatgtagagtggtatgggatccaccagaggatgatggtggt
tgtgaagttgacagttatattctagaaaaatgtgagactagaagaatggtctggtctact
tattctgcttcagtggtcactccctattgcaatgtgacgcgccttgtggaaggtaatgaa
tacatattcagagtcagagcagaaaacaagatgggaacaggtcctcccatggagagcaag
cctgttattgccaggacacagttcagcccacctggtccacctgatccaccagaggtcacc
aaaattggcaaggatgaaatgactgttatatgggctccccctgaaaatgatggtggaaaa
tccattactggctacattctggaaagaaaggagaagcgtgctgtacgatgggttgcagtc
acaaagagtcctatctctgagagacgtatgaaagtaatcaatttgattcctaaccatgaa
taccaatatcgtgtgaaagctgaaaatgaagttggattgggagaaccaagcaaaccatca
agaccaactgctgcaaaagatccaattgagccccctggtccccctggcagcctgaaggtg
gttgacagcacaaagacttcagttactcttggctggtctaagccagtgtatgatggtggt
gctccaatcattggatatttggttgagatgagggataagattgaaatggaaggtgaaaaa
gagagagatccagatgagggctgggtgaaatgtaatgttggtatacagcttgtcctcact
gaattcacaatcagcaatttggatgagaggaaacaatatgaatttcgtgtttccgcacaa
aaccaagtcggcataggccgtcctgcaagacttaaagatgctgtgacaccaaaggaaatt
catgaaatacctgagattgacctggatgccagtttgaggaaaggtctcagtgtaagagca
ggatgtcccattaggctattcgctacaatcagaggaaggccagcacctaaagtgacctgg
aaacgcataggtgttgacaatgttctcaggagaggtcatgtggatcagattgatacaatg
accttccttgtcatcccagagagcacacgtgaagactctggaaaatactctctgacactg
tcaaatccctcaggagaaaaagctgtatttgttcgtgttaagattttagatactcctgga
cctgttgatggactggaagcaacagatgttacaaagacgtcttgtcagctctcctggtca
cccccagaaaatgatggtggcagtccaattctgaactacattgttgagaagcgtgaagta
gacaggaagacatggacaaattgtaccaatgacctaaagaagactagctttaaaatcaca
aatctgacaccaggaattgaatattacttcagggtcatagcagtcaataagtatggtatt
ggggtaccaaaggactccccaaaatcctatttggccacagatccaatgagtgaaccagat
cctcccaaaaagatggatgtcttagagattacaaagaacagtgctacagttgggtggctg
aagcctctgagagatggtggagcaaagattaatggatacattgttgattaccaggaggct
ggtcaacctgaggacaaatggacaccatattcagttgtaaaagacttaagtattgtcatt
gtaggtctgaaagaaaacacaaagtatagattcagggttgctgcaaggaattctatagga
tgcagcctcccaagagaggctgaaggaatctttgaactgaaagaacacctgatggcacca
aagatcattatgcctgatgtggttactgcaaaggcaggaaccaaactgaaagttgaagca
cttgtatctggcaagcctgttcctgtcactacatggatgagaggaagtgatgatgtggtt
acatctgatcgcatttctgtgcaaaagacactatcctcatccacatttatgattaaagat
gtttcaagaaaggacagtggatattacagccttactgctgagaacaacatttctaaagtc
aaccaaatccttagacttataatttatgatatccctggccctccagagggtcccttggaa
attcttgaggtagacattgatgcctgcactcttgcatggaaccagcccacagaagatggt
ggtagcaacataacaaactatgttgttgagaaatgtgatgtgaccagaggtgattgggtc
cctgctgtgtctaactgcaccaagaccagttgcagagttgtaaagctcacccctggaaat
gagtatggttttcgagtgcgtgctgagaatcgctttggaatttcagaaccaatctactcc
gaaaaaatgattgccagatatccctttgacccacctagtgaaccaaggaattgctatgtc
aagaatgttcacaaagaatatgttgttttatcctgggaaaggccagcaaatgatggtggt
agtcctattataggatactctattgagcgcaaagagagaaacagccttctatgggtcaag
gcaaatgagacacttgttcgtgcaactgaatactcttgctcaggccttattgaaggtctg
gagtatatattcagagtgtctgccgtcaacaaagcaggacagggcaaaccaagcaaacca
acagagatcattactgcaaggactccagttgatccacctggtaaacctgaggtccttgat
gtaacaaggaattctgtgtctcttgtctggaaccgtccaaaacacgatggtggtagcaaa
cttattggttattatgttgagtctttgaaacttacaggtgacaagtgggtacgtgtaaat
gcaaatagccaaaatgtgcccaaagaggagtatgttgtcactggacttgaagagggtgcc
caatacaaattcagaatcattgcaaagacagcgatttcagtcagcctgccctcagaagaa
tctgatgcaatcacagtcattgcagagcatgttccaccaaggattgagattagtgtggaa
atgaagaaccttatcactgtaaaagctggaactaatgtcaaccttgaggctgaggtctat
ggcaaaccactaccaaagattacttggaagagagacggcattccaataaaacttgttgaa
ggcataaagatgtctcaaaagagacacctctttatcctagaactgttctctgtgaccagg
aaagagtctggagaatataccattgttgctgaaaacccaagcggcactaagtctggcaac
attaagctgaaggtcctggacaagcctggacccccagcctcaattaaaatcagtcaggtt
tttgctgaccgggtcaaattgcggtgggagccacctctttcagatggcggtgctgaaata
actaactacattattgacaaacgtgaaacaagcagagctaactgggctatggttacttcc
aaccttagtggccagctcacagattgctcagttgagaaactaattgagggccatgaatat
gagttcagagtcagtgctgagaacaaatatggtgttggtgacccaattgtgactaactct
gtgattgccaagaatccatttgatgttcctggaccatgtgaccctccagttattaccaat
atcatcaaagaccacatgacagtgagctggaaggcccctgctgatgatggcaaggcacca
atacttggatacatggttgagaagcgtgaaactcaggaactcaactggtccaaagtaaac
agacgacctgtcattgatagaaccattaaagttggaagtctcactgagggttctgagtac
gagttcagagttattgctctcaataaagctggtcttggcaaaccaagtgatgcttctaag
gctgcacttgctgtggatccattgtatcctcctggaccacctgcttttcccaaagttgtt
gactctacacacagctcagtcactctatcctggaccaaacctgcctatgatggtggatgt
gaaatcttaggctacctggttgaagtcaagagagctgattcagaggaatggctgaagtgc
aatataccaaaaaatctccaggcaacaaagttccttgtcagcggtcttattgacaacact
gagtatcagttccgtgtaacagctatgaataaaattggctacagtgagccaagtgaagtt
cctgggaagcatctggcacaggacattttaattgctcctgaagctgaacttgatgcagac
cttagaaaagcattggtattacgtgctggagtcacaatgagaatctacgtaccaattaga
ggccgtccagcaccaaaggtgacatggagcaaggtcaatgccaacttaaaggagaggcaa
ggtcttacaatcgacacaactgattgggatacctttgtatactgtgagaacatcaacaga
tatgatgctggaaaatatgtactaactcttgagaacagcagtggaaccaaatcatacact
attgtcgtcaaggtcttagatacacctggaccaccactcaatctgacagtcaaagagaca
tcaaagaatcatgcatccatcacctggtatcctccattaattgatggtggaagtccagtg
aagagctatgttattgaaaaacgtcttgctgagaggaaggcgtggacttgcgttgctcca
gagtgtcctaaaacttctttcagaatcactaatctagaagctggaaaagcatattgcttc
agagtctcagctgaaaatgtgtatggtattggtgagggtgagacagctggaccagtaaaa
gcctcagagcaacctggaccagttacagatttcaagccagtattggtcaccaaagattct
tgcaaccttacttggaagaagcccattagtgatggtggaagccatattgttgcatatgct
ctagatatcagtgagggtgaagataaatggaagcagcttatgaggtccaagcaaatgcag
cacacagttaaggacctacaagaaggaaagcaatacttattccgagtaagagcatttaat
gagtcttctgaaggacctccaactgaactcactgtggttgcaaaggatcaagttgttctg
ccagactgtgaccttaaaggcttgccagactcttgttatgtagcaaaggagggaagtact
attcacattactatccccattactggcattcctgctccaacagtcacatggaagaagggt
ggtgttactttgggagatagtggaagaatctctgttgactccacagtggcaagcacaacc
ttgctgataagagactgccagagaggcgatgctgacaaattttatatcattttgaaaaac
agtgctggtaccaaagaatctaccattaacatcaaggtggttggaaagcctggaatttgc
tcagggcccattatttttgatgaaattacagctgatggaattactctggagtggggtcca
ccaaaggatgatggtggatcagaaatttccaactacattctagagaagaggccttctaca
agtaataagtgggtcactattgcttcagctattcagaagaacaatatgagggtcacaaga
cttcatgaaggaacagaatatctattcagagtatgtgctgaaaacaaatatggtgttgga
gagttcctcaaatctgatccagtggtagctaagcatccattcaatgcaccagaggcacca
gctccaccaaacatcctgagtattcaccatgagtctgctattgtgtcatggtctgatcca
agggataatggaggctctcctattacaggatatcatgtggaattcaaagataggaacagt
ttattgtggaggagagccagcaagacacctttgagagtaaaggagtgcagagtgactggt
ttagttgaaggtcttgagtatgaattcagagttatggctataaatatggctggacttgga
aaaccaagtaaacccacagaagcacttgttgcacttgatccaattgatcctcctggcaaa
ccagaagtgatcagtgttacaagaaacactgtaacactcatttggactgcacctacgtat
gatggaggacacaggctgactggatatattgttgagaaactggagcatccaggaaaagtc
tggatgaaagctaatcatgtcaatatccagagctgtgccttcacagttacagacttgcaa
gaaggcagcatgtacaatttcagaattagagcaaagaatgcagctggtgccatcagtgct
ccttcagaacaaactgacacacttgtctgcagagatgaatatgagccaccaactattaca
attgatcctgaaatgaaggatggtgtcactgtcaaggcaggagaaacaattgttatttct
gcatcaagtattcttggaaaacctccacctacagctgtatggtctaagggaggaagagaa
ttaaagccatctgatgttgtccagattacaagcacacccacatcttcaactctgtcaatc
aaatatgccaacagaaagaacactggagagtatacaattactgcaagcaatccatttggt
attaaggaagaaaaagtgaaagtgaaaatcctagatgtgccaggtcctccagggcctatt
gaggtcagcagtgtctctgctgaaaagtgcacactgacatggttaccaccaatagaggat
ggaggctgtgctatcaaatcttacattcttgaaaagagagaaactagccgcctgctttgg
acaaagcttgctgaaaatataatggattgccgtcatgtagccaccaagttgattaaaggc
aatgaatatatcttccgtgttttagctgtgaatcagtatggtattggcgatccaacccag
tctggtccagtcaaaatggttgacagctatggtaggttcaatncaccatcaaaaccagaa
attgacaatatcagcaaaaatgctgtaactatttcctggaaaaggccagctgtggatgga
ggaagtgacattagagggtacagtgttgagagaaaagaaaagagaggtatgagatgggtt
agagcttcaaagaagaccatctctgatctacgatataaagtaacaggcctcagtgaagga
gttgagtatgagttccgtgtaactgcagagaacaaagctggttttggagaacctagtgag
ccatcacaaccagtgctgacaaaggatatttcatatccacctgggcctccatctaaccca
agaattactgataccactaaaacaacagcaacatttaactggggaagacccttctatgat
ggtggacttgatgtgactggatacattgttgagcacaaaaaggaaggacatgatgactgg
gtccaagacacagccacgccgttgagaataactgagtttgtagttccaaacctacaagca
ggaggcaaatatagctttagagtctgtgcaattaattctgaaggacgtggggaaccagct
gaagttgagaaagttgtggaacttgttgatcgtgaagaactccctgactttgagcttgat
gcagagctgagaagaacacttgttgtgcgctctggtgcttccattcgtatatttgtgcca
attaagggtcgtccaactccagaagttacatggatgaaagaggatgttcctcttaaaggt
cgtgcccatattgatactactgagtcatacactcttgtagttatcccagagtgcacaaga
tatgatgctggaaaatacatcttgacattagaaaatgttgctggaaagaagacaggattt
gtcaatgtccgagttgtggacacacccgggcctccagtcaacttaaaaccaagagaaatc
accaaaaatagtatcactcttcagtgggagattccaattattgatggtggatctaagatc
ataaattacatcattgagaagcgtgaggcaactagaaaagccttctccacattaactaca
aactgtcaaaagtgttcttacaaagttaccaatttggaagagggggctgaatattacttt
agagttttagctgaaaatgaacgaggtattggtgagccagcagagacacctgagcccatc
agagcctctcaagctccatctgcacccgacaacctaatagtcacagacgtgtcaaaggac
acagcaactcttgcatggaccaagccaagacatgatggtggtagcagaatcactggctat
gtgattgaagcgcagaagaaggattctgaccagtgggtacatgtcacagcaataaaggct
ttggactacactgcaacagatttgactgagaatgcagagtatgtattccgcatttttgct
gtgaacagttcaggcagaagtgaacctcgtgaatgccggccagttgtaatcaaggagcag
accacaccaccaggatttgacctcagaggtgtctatcagaagctggtggtagccaaagca
ggtgataatgtgaaggtggagattcctattttgggtcgtccaaggccatctgttgtctgg
aagaaaaaagatcgggaacttaagcagacacagagaattaatattgacaacacagcaaca
tctacgattctcaatataaatgatatcaagcagaaagatgcaggacagtattcaatgact
ggaaagaacatactgggaactgtgacagagaccattactgttcaagtgcatgacatccca
ggacctccaactggaccagtaaaagtagatgaagtgtcttctgactatataatcatatct
tgggatgcaccagagaatgatggaggagttcctatcaataattatatagttgagatgagg
gaaacaacaggcacaaattgggtggagttggcagctactgtcattcgcacaacattcaaa
gctgctcgtcttacaactggaatagaatatcaattccgtgttaaagctcaaaacagatat
ggtgttggcccctgcataatatctgagccggttgttgctgcttatccatttgatgtacca
ggccaaccaggaattccacaagttgttgcctttacaaaagattcaattacaatcagctgg
aatgaaccttcctcagatggtggaagcccaattttgggctatcatattgagagaaaagag
aaaaacagcatactctggcaacggattagcaaagcccttgtggttggaaatattttcaaa
tcatcaggtctgatggatgctattgcatatgaattccgtgttattgctgaaaacatggct
ggccttagcaaaccaagcaagtcatctgaaatggcatatgcacttgatccagtggaccct
cccagtcaacccgtggcaattaatataactagacatgaggttacccttcagtggttgaag
ccagagggtgatggtggtttcccaatcactgggtatacagtggaaaagagagaactgccc
aatggtcgctggctcaaagcaaatttcagcaatattcatgagacaagctttactgtaagt
ggcctaacagaagatgcttcatatgaattccgtgtttttgcaagaaattcagctggatct
attagtcggccctccaaaccctcagaagtcataatctgtagagatgatattcaggaaccc
atgcttgatgttgattcgagtttcagtagtattgtggtggtgaaggcaggagacatcttt
agactagatgcaaatgttactggcagacctatcccatccttggtatggacaaaagatgga
aaggaccttgaggatacagcaaaaatagaaatcaaaacagctgacttctacacatgtttg
atcaataaagactcttcacgaagagatggaggtgcatttactctcactgccagcaaccct
ggaggatttgcgaagtatgtcttcaatgttaaggttcttgacagacctgggcctccagaa
ggcccacttcatgttactgacatgacaacagagaaatgtattctttcatggttgccacca
cttcaagatggaggtgcaaagattgactattacatcattcagagacgtgaaacaagcaga
cttacttggacaaatgtagctacagatttacaagtcaaccgctataaggttaccaaattg
ctgaaaggaaatgaatatatcttcagagttatggctgtgaataaatatggagttggagag
cctcttgagtcagagcctgctgttgtcactaacccatatgtagcttctgatccaccacaa
gctcctgacgtgacaacaattacaaaggactctatggtagtttgctggggacaccctgaa
tacaacggcggaagccccataaatacttacataattgaaagaagagataaaactggtctc
cgatgggtcaaatgcaacaagaggacagtaactgatctgcgcttcaaagtgtctggactt
acaccagggcatgaatatgaattcagagtgcttgctgagaatgctgctggtttaagtgct
ccaagcccttcaagtccattttacaaggcatgtgatacaatattccagcctggaccacca
ggaaatccaagaattttggacacaaccaagtcatccataactgttgcatggaacaaacca
gtttatgatggaggatcagacatcacaggatatattgtggaaacctgtctcccagaggaa
gatgaatggacagttgtcactccaagagagggactcacaggaacatcatttaccataaca
aacttaacagaaaatcaggaatataagattaatatttctgctctgaacagtgagggtgtt
ggagaacctgcatctgtacctggctcaccaaaagcagaggatagatatctccctcctgaa
attgaccttgattcagaccttcgcaaagtagtgaatgttagagcttctggcactttgaga
ttatttgtgccaattaaaggaagacctgcaccagaagttaaatggtctagagagcatggt
gaacctcttgataaagcatgtattgaggcaacatcatcattcacatcacttgttgttgat
aatgttgacaggtttgatagtggaaagtatatgttaacagtggaaaacagttcaggaagc
aaaacagcatttgtgaatgtcagggtgcttgacacaccgggggcaccacaaaatctcaca
attaaagaaattacaaaagattcagtctcacttatctgggatcctcccatcattgatggt
ggctcaagagtcagacactatcttgtggaaaaacgtgaatcaacaagaaaggcatattct
attgtaaatgcctcctgccccaaaacaagctgtagaattggtgatcttcaagaaggtagt
ttttacttctttagaattttggctgaaaatgagtatggtattggccttccagtggaatct
gctgaacctgtcaagatttctgaaaagcctcttcctccgggtaaagtgactcttaaagag
gtaactggcagcactgtaactctatcttgggaaaagccagagcatgatggaggcagcaga
atcactggatatattgtagaaatgcaagggaaaggcagtgacaaatggactcaagtcatg
actgttaaagttacagaggcagttattgccggtctgactcaaggtgaagaatattcattc
cgtatatcagcaacaaatgaaaaaggaacaagtgaccctcgtccactcagtgttcctgtg
gtggcaaaggaccttgttatcactcctgcattcaaacatttattcagtacattcagtgtg
ctagcaggtgatgacctcaagatagatgtaccatatgttgctcagcccaaggctgcagtt
acatggctcaaagatggcattgccctaaaagaaacaacaagagtaaatgctgaagtaact
gaaaagcatctctatcttgtaatcaaggaggctacaagggatgatgttggaaaatatact
atcaagattacaaatgcagttggagaggctatgactgatatccatgttgttgtacttgac
aaacctggtcctccaattggaccaataaaaatagatgaagtaactgcagatagtgtgaca
ctatcatggcaaccaccagagtatgaaggtggatgtacaattaataattatattgtggaa
aagagagacacatccaccacaaactggcagattgtgtcagcaacagtggctagaacaacc
attaaggctgcaagactgaagactggctgtgagtatcaattcaggattgcagctgaaaac
agatatggaaaaagctctttgctcctgtctgagcctgtaattgcacagtatccatttgag
ctcccaggtgcaccaggacctcctactattcagtctgttaccaaagaaagtatggttatt
gtttggagcaaacctggcaatgatggtgggagcaaaattctgggttaccatattgaaagt
aaagaaagaaatagcctgctgtgggtaaaacaaaataagacaattattccagacacaaga
ttcaaggttagtggtcttgaagaaggaattgagtatgagttcagagtttatgcagagaat
attgttggtttgagcaaagccagcaaagtgtcagacatccaggtggcaagagatccttgt
gatcctccaggcaaaccagaagcagtcattgtaaccagaaattctgtcacactaaggtgg
acagcaccagagtttgatggaggcagcagagtcacaggctatattgtcgagaagaaagag
ttgcctaatggtcggtggatgaaggccagtttcactaatatcatagaaactgaatttgtt
gtcagtggcttggtggaagagcaaagatatgaattccgtgtgattgcaaaaaatgctgca
ggtgtatccagtgtaccatctcaaagtactggtgcaatcacagcaaaggatgaggttgag
ccacctatgattgatttggatgctaaatatgcccaaactattgtgattaatgctggagaa
tccttcaggattgatgctgggatatttggcaaacctgttccatcagttcattggataaaa
ttaggtcaggaacttgaaaatacagctaggcttgagattaagaatacagacttcacaact
tctttaagtgtcaaagaggctattcgcgttgatggtggccaatatacactgctgctgaaa
aatgttggtggggagaaatctgtagctgtcaatgtcaaagttctagaccgccctgggcca
ccagatggtccaatttcaatctatggggttacaaacgagaaatgttgcatatcttggaaa
gcaccattacatgatggaggtgctgaggtatctcattacactgttgaaagaagggagacc
agccgattggtttggactgttgtggaatctaaagtgcaaactctgaacttgaagattacc
aaacttcttcctggaaatgaatacatcttcagagtgatcccagtcaacaaatatggaatt
ggtgagcccctggaatctgatccggtcattgcagcaaatccattcgtcactcctgatcca
ccgactggtgttgaagtatccaatataacaaaggactccatggttgttacatgggaaagg
cctactaatgatggaggaaatgcaattacagggtatgtaattgaaaagcgggataaagaa
ggtgtcaggtggataagatgcaacaagcgtgtagtcagtgaactgcgcttcagggtgacg
ggtcttctggaaaaccgcagttatgagttccgtgttagtgctgagaatgcagctggagtt
ggcaaaccaagtgctcctactgtgtactacaaggcaacagatccaatcttcaggccaggt
ccaccaaacaaccccaaggttgttgatatttcaaggacatctgttgtactacagtggggc
aaacctatttacgatggtggttgtgagattcaaggttatattgttgaggcttgtgaaagc
acatctgatgaatggaccatgtgcactccacccacaggaatcaaagaaacatattttgaa
attaaaaagcttttggaaaaacatgaatacaaattcaggatttgtgccataaacaaggtt
ggagttggtgaaaatgctgatatcaaaggttctgttcttgtggaagacaaactggaagca
ccagatactgatcttgatgctgacttaagaaagatcatcaccgttagagctggagggtct
cttagattgtttgttccaatcaggggccgacctacacctgaggtcaaatgggggaaagct
gaaggtgaaattaatgaaacagcacaaattgatattacaagcagctatacctcacttgta
attgaaaatgtcaatagatttgacagtggaaaatacactttacaattggaaaactcaagt
ggatcaaaatctgcgttcattagtgtgagagtacttgatactcctgatgcacctacaaac
ttccatgtgaaagaaataacaaagaattcaataaccctaacatgggagccacctttgctg
gatggtggagctaaaatcaaaaattatattgttgagaagcgtgagagcacaagaaaagta
tactctactgttgcttcttgcaataaaatgacatataagattgaacaacttgaagaaggt
aaaatatacttctttagagtccttgctgaaaatgaatatggtattggactacctgcgaag
actccagaaccactgaaaatctcagaagtgccacaacctcctggaaaaatctctgttttg
gatgttacacgcaagagtgtttctttgtcttgggaaaaaccagaacacgatgggggcagc
agaataactcactatgaagttgagatgcaagcaaaggagagtgaaaaatggtctctgtgt
gcacaagttaaatcacttgacaccactgttaccaatttagtccaaggtgaagagtacaac
tttagggtaattgcagttaatgacaagggaaaaagtgatcccagacttttggcacaccct
gttcttgcaaaggatctagtaatcgagccaactgtaaggacaaaacttagtacttatagt
gtacaagttggccatgacttaaaagttgaagcacgaatcagtggtcatccaaaaccaact
attacatggactaaagatggcgcagttctaaaacagaccacaagggttaatgttgcagat
actgcacatcatacaactctatccattaaagatgcaacaagagatgatggtggtatgtac
aatgttacagtggctaatatactgggacaaaaagaggccatcattgaaatcatcatactt
gagaaacctggtccaccaacaggccctgtcagaatagatgaaataagtgcagagagtatt
acattgtcatgggatccaccaacctacactggaggttgccaaatttcaaactacattgta
caaaagagagacactactacaaccaactgggtagttgtttcagctacagtagcaaggact
acacttaaagttggaaatttgaaaactggagctgagtatcaatttaggatctttgctgag
aacagatatggaaaaagctatgctttagactcagagccagttgttgctcagtatcctttt
aaagaaccaggggcccctggaactccatttgtatctgcattcacaaaagagtctatggtt
gttgagtggcacaaacccatttcagatggtggcagtgctattcttggatatcatcttgag
agaaaggaaaagaacagcatcctctggacaaagataaataaaacacttattcaagacacc
agatttaaaacttctcctttggaggaaggtattgaatatgagttcagagtctctgctgaa
aatattgttggaattggcaaaggcagcaaagtttcagagggctgtgtagcccttgaccca
tgtgatcctcctggtacccctgtgccgattattgtcacaagacactcaatactactcagg
tggacaccaccagaatatgatggaggcagtatggtaactggatatgttgttgagaaaaga
gacctcccagatggccgttggatgaaggcaagttttgcaaacattctagaaaatgagttt
acagtcacaggtctgacagaagactcaaaatatgacttcagagtcattgccagaaatggt
gctggatcagtcagcaaaccttctcagaccacaggacctatcactgctaaggatgaggtg
gtaccaccaacctatgagattgactcacagtacacccaaattatctctgtaaatgctgga
gatacatttacactggaggcatctgtacttggaaagccagttccaaccatgcagtggttc
aaaggtgatgtagaagttgaaacttcagcaagaactgagaccaagaacactgacttcaaa
gcagttcttgttgtcaaagatgctattagagttgatggaggacagtatactttgcatctt
actaatgttggtggaactaaatctgtgtccttcaatgttagagtgcttgatagacctggg
cccccagaaggacctttgacagtttctaatgtaacaagtgagaaatgctcattgtcttgg
cttcctcccatacatgatggtggcagcaatatttcccattatgttattcaaaaaagagaa
acaagccgtcttgcttggactgtagtgtctagtgattgtggagcaaccatgtttaaggtt
actaagcttcttaaaggaaatgaatacatcttccgtgttatgggtgtcaacaaatttggt
gtaggcgaacctttagaatcttcaccagtatttatgagaaatccatatgttccccctgga
ccaccacgagaactagaagtaacaaatatttcaagggattccatgactgtatgctggact
cgtcctgagactgatggtggaaatgagattgttggttatattgtagagaagagagataga
gttggggtcagatggacaaaatgtaacaaacgcagagtcacagaccttcgtttcagagtc
acaggtctcacagaagatcatgaatatgaatttagattatctgcagaaaatgctgctgga
gttggaaaaccaagttcaccaactgtgtattacaaagcatgtgatccaacatttaaacct
ggcccaccaactaatgcacatctcgttgacaccacaaagaactcagtaactattgaatgg
agtagaccaatttatgatggtggcttagaaatccagggctacattgtagagatttgcaaa
gctgatgaggaggaatggcttacatgtaccccgcctacagggttgaatgatactaaattc
accataaccaaactgacagaacatcaagagtataagattcagatatgtgctcttaataga
ctaggagttggtgagccagttgctttgccaggcacagttaagcctgttgataaaatggat
ccacctgaaattgaactcagttctgagttaaggaagggcattgtagtccgtgctggagga
tccatgagaattaacatacccttcaagggccgacccactccggagatcaactggactaag
gatgatggtgatctacctagtaaagctcaaatcgaaaagggtctggattatacccaactc
tcaattgacatctgtgacagaaatgatgctggaaaatatactctgactctagagaacagc
agtggtaccaagactgcatttgtttcagttaaagttctggacacaccaggagccccacaa
aacttagttgtaaaagatatcacaagaaattatgttactcttgtttgggagcctccactt
attgacggtggtgccaagataaagaattatattgtggaccaacgtaaatcaactaggccg
gcattctctaacattactacaaaatgtaccaagactaccttacgtgttggtgatctcact
gaaggtggcatttattatttcagagtcatggctgagaatgagtttggtgtgggtctgccc
atagaaacagaagattctgtaaaaacagcagatcctcctctaccagtgggtaaagtcact
ttgactgatgtgactaaaactactgcatcactgtcatgggagaaaccagatcacgatggt
ggtaatagaattataggatattatattgaaatgcagcctaaaggttctgatgactgggta
gtggcaacaactaccaaaacatgtgagggaacagtcacaggacttagcactggtcgtgag
tatctttttagagtttcagcctacaatgataaaggaaaaagtgatccaagggcactagct
actccagtgacagccaaagacattacaattgaaccaaccctccaagtgactttcaacaca
tacagtgtcaagtgtggcgaagacctcaaagtagaaattccagtaagaggtcgtccagtg
ccaaaggttgcatggagtaaagatgagcaagcattaaaagagacaaccaggctaaatgtc
tcaagcactgcaacatcaacaatccttagcattaaagatgccaatagagaggattctggc
aaatatacagtaacagctacaagcagtgtaggtacagcctcagaggaaattggcataatc
atcctggacaaacctggaccaccagttggaccagttaaaattgaggaaataagtgccaat
tatgttgttatttcctgggagccaccagtgtacactggtggttgtcagttaaacaattat
gttgtggaaaaacgtgacacaacaaccacaaactggcagactgtctcagcaacaattgca
cgtacaacaatcaaaatctctaaactgagaactggtgtagaatatcagttcagagtgttt
gctgaaaacagatatggaaagagctcttcactggactcggtacctgtcgttgttagctac
cctttcagtgaaccttcggcaccaggcacaccatttgtgtcctcagtgacaaaggaccac
atggtcattcaatggaagccacctagcaataatggaggtagtgctattcttggttatcat
attgagcgcaaagaaaaaaacagcattctgtggacaaaacttaacacactcctccttgct
gatacacattttaaaacaaatggtcttgaagagggtattgagtatgagtacagagtgtat
gctgaaaatattgcaggaatgagtccatttagcaaagtttcagaaagtgttgttgcacgt
gatccatgtgacccccccggtactcctgaagctatcgttataacaaggaaccttgtcaca
gttcagtggacaaagccacaatatgatggaggcactacagttacaggttatattgttgag
agaaagaagttgcctgatggccgctggatgaaagccagcttcgcaaatataattgacact
caatttacaatcacagaattaacagaaggagacagatatgaattcagagtaattgcaaga
aatgcagctggaattttaagtgaaccttctgaaagcactggcccaattactgcacaggat
caaattgaagcaccttcagccactttggattccaaattcaaggatgtcataattgtgaat
gctggtgagacatttaccattgacgctgacattgctggtaaaccaatccctgacataatt
tggcttaaagatggaaaagaaattgatagtgctactccaagaatggaaattaaatccacc
atcacacgcactgttcttactgtcaaagactgcataagagtagatggtggacattttgtc
ctaagtcttagcaatgtaggtggaacaaaactggtgactgtaaatgtcaaagttctggac
agacctggtccaccagatggccctctgaaggtaaccggtgtcaaagcagagaaatgctat
ttacattggagccatccaacacatgatggtggagctgctatttcacattacatcatagag
aaaagggaaaccagcagactctcttggactatggtagaaccaaaaattcaagctatcagt
tacaaagtcaccaaactcttaccgggcaatgagtacatctttagagtcagggcagtgaac
aagtacggtattggtgaacctcttgaatctgaaccagtcattgcaagaaatcctttcaag
acacctggtcctccttcaactccagaagcaagtgcagttactaaagactcgatggttctt
acatgggaaagaccagaggatgatggcggttcaccaattgagagctatgtcctggagaag
cgtgataaagagggtgtccgatggacaaagtgcaacaaaaaaacactaagcgacctgcgt
ttcagagtcactggattaacagaaggacactcttatgaattcagagtatctgctgaaaat
gctgctggtgttggcacaccaagtgaaccatcagaatattacaaagcatgtgatgcaata
tatcctcctggtcctccaagcaatcccaaagtaacagatcattcaagcacaactgtttct
cttgcatggagtagacctatttatgatggtggtgcactagtctctggatatattgttgag
atgaaagaagccagtgatgatgaatggatagtgtgtacacctccaactggagtccaaacc
acccacttcacagtcaaaatgctgaaggagaatgctgaatataatttccgcatttgtgca
gttaatattgaaggtgctggagatcatgttgatgttcaaggctctgtaattgctgctgag
aaacttgaggcccctgaaatagagttagatgctgacctaagaaaaattgttactgttcgt
gcaagtgcaacactgcgcttatttgtcaccattagaggaaggcctgagcctgaagttaaa
tggtcaaaggcagatggtcctctaacagaacgtgcccaaattgaagtcacaagctcttac
accatgcttgtcattgacaatgttgacagatttcacactggcaaatatgttctgacactt
gaaaataatagtggcactaagtctgcattcattaatgtcagagtcctggactccccaagt
gctccagttaacttattggtaaaggatgtcaagagggattcagtccaactacagtgggaa
gctccacatattgatggtggtgctaaggttactcattatgttgtggagaaacgtgaatcc
aaaagaatggcatttacaactgtggcaaataactgtgtcaggaattcattcaaggttgat
gacctccaggagggaggtgtttattatttccgtgtactggctgtgaatgaatttggtgtt
ggcttgcctgtatccaccacagagtcagtaaaagtatcccaagcacccctacctcctggt
aaggttacacttgttgatgtaactcgccatactgtaagtctctcatgggaaaagccagac
catgatggtggcagtaaaataactggctacatagtagaaatgttgaccaaagggtcagaa
aaatggacagcatgtgcaacagtaaaagcactggaagccagaattgaaggacttacaaga
ggagaagaatattctttcagaattgtagcaatgaatgacaaaggaaagagtgatcctaaa
ccattaggagcacctgttgtggccaaggatatcacaattgaacccatcattgatttgctg
tttaacacttacagtgtaaaagctggagaagatctcaaaattgatgttccattcagaggc
agaccccatccagaagtgacatggaagaaggatggccactcactgaagcaaacaaccaga
gtaaatgttctgacatctaaatcatcctccaagattactatcaaggacacaataagggaa
gatgctggaaaatatgaaattacactgaccaactcaattggtattaaatcagctgaaata
acagttattgttcttgacaaaccaggtccaccaatttcaatcagagtagatgaagtaagt
gctgatttcatctccttatcctgggatcctccagtgtatgatggtggttgtcaaatcaac
aattatgttgttgagaagagagatacaacaactacaacatggcaaattgtttcagccact
gtggcacggacatcaataaaaatatctcgtttaactcagggaacagaatatcagttccgc
attgctgctgaaaatcgttatggcaagagtcatgttgttgactctcctccaatagttgca
cagtactctttctcaccaccaggtcctccagctgatcttcaggttgctaacatcacaaag
tcaggcatgttagttacatggaaacaaccagtcagtgatggtggaagccccatcattgga
tatcatttggagtgcaaggaccaaagtagcattctttggacaaaggtcacaaggaatcta
gttcctgatactcagttcaaagtaactggtcttgaagagggtcttctttatcagtacaga
gtgtatgcagaaaatattgcaggcattggaacttgtacaaaagcttgtgatcctgtagct
gcaagagatccatgtgatcctccaggtcagccaattgttatgaacataacaagaacttct
gtttctctctcctggacaaagcctgaaaatgatggtggagccaaggtgactggttacatt
gttgagcgaaaagaacttccagatggtcgttggttgaagtgcaatttcaccaatctccaa
gagacatattttgatgtgacaggtcttattgaagatcagagatatgatttccatgttatt
gcaaagaatgcagctggtttacttagtgaggcatctgagggtacaggccctgttacagta
aaggatgatgtagatccaccttgcatcacaattgaggacaaactcaggcaacttgttgta
atcaaagctggagatatactgaaaattgatgccgaaatttcaggccgtccaattcctgtg
atttcatggacaaaagatggaaaagaaattgatgctaaggcaagagttgaaatttcatca
actcgtactaccacaacattgattgttagagattgtattagaagagactctggacagtat
gttctgacattacagaatgttgctggtacaagatcattagcagtgaactgtaaagttctt
gacagacctggtccatcatctgggccacttgaagtaattggtatgacagcagaaaaatgc
tccttatcctggggccccccccaagaaaatggtggtgccgaaattcagcactacattgtt
gagaaacgtgagacaagtcgcctagcctggaccctagtctatgcagacatgaaagcaaca
acatgcaaagtgacaaaactgcttaagggcaatgaatacattttcagagttctaggagta
aataaatatggaacaggtgaagctttagagagtgatcctgttaaggccatggatcctttt
acagtacctgctgcaccaacaaatgttgaagtcactagtgtaacaagtgacgcaatgaca
atctgctgggaaagacctgtctctgatggtggcagtagtattaatggctatgtaatagag
aaacgtgaaaaatctgggctccgttgggtacgtgtcaacaaaaagcctgtttatgatcta
agagtcaaagcttctaatctgcgtgaaggttgtgaatatgagtaccgtgtctatgcagag
aatgctgcaggcttgagtgcaccaagcttgccttgcccattgacaaaggcagaggaccca
ttattcttaccatcaccacctactaagccaaagatcattgattctaccaaaagcacaata
acactgtcttggaacaagcccttgtttgatggtggttcccccgtcacaggatactcagtt
gaatacaggaaaaccaatgaggatgactggattgttggagtccaacacactaagaacact
gagttcacagttgtagggctgacatcaggagcagagtatgtttttatggttagatcagtt
aacaaaattggtcctagtgaaccaagccctgaaactgatccacaagtagcaaaggacaga
gaagatgagcctgttttcctcattagtaatgaaatgagaaagactctaattgttaaagat
ggcagctcatttactttaagagttccattcaaggggaagccagtgccaaatgtaatgtgg
aataagcccgatgttgacctgagagttagggcagcaattgataccactgatacttgcaca
tccatcacagttgagcaagctacaagaaatgactcgggcaagtacaatgtaactcttcaa
aatgttgctggaacagttacattaacactgactgtaaaagttcttgattcacctggacca
cctgccagtatagtagttaaagaagtaactaaaaattctgcaactgttacatgggacacc
cctgaaaatgaaggtggtgctcctgtcaagaactatctcattgatatgcgtgaggcaagc
aaaaagggatggaccagggttacagatagctgccaccgacttactttcaaagtaactgac
cttcaagagggaggtgtttattatttcagagttactggtgaaaatgaatatggcatgggg
gtaccactcgaaaccaaagatggaactaaaattacagaaaaaccaagtccaccagaaaag
cttggtgtaacagaggtcacaaaagacagtgtcacccttgcttggagtaaaccagagcat
gatggaggtagtaagattaccaattaccaggttgatgcactggagaaaggacagcagaag
tggataaagtgtggtgtcaccaaatcaatgcactttgtcgtctatggcttgcgagaaaat
gctgaatacttcttcagagtttgtgctgaaaaccatgctggacttagtgaccctaaagac
atggttatgccagtgcttgttaaagatcaactagaggctcccgagattaacatgaagaac
ttccaacgtaatactgtctatgtaaaggcagggtcaaaccttaaggttgagattcctctt
acgggaaaaccactgccaaaggtctctctctcgaagaatgatcagattctgaaatcaacc
atgaggttcaattcggaagtaactcccgaatcccttatcatcactttacgagagagtgtt
gctcatgatgcaggaagatatgacattactgcgtccaactcaagtggaaccaccaagtcc
tttattaatattgttgtgctagacagaccaagtctacctcttgggcctgttgagatttgt
gataccacagaagacagtttaagtctgaagtggctccctcctgcttatgatggtggtagc
ccaataacaaactacattgtcctaaaacgagaaacaactactgcaaactggattgaagtt
tcatctgcagttgcaagatgcacaatcaagattatgaaactgactacaggagttgagtat
cagttcagaatcagggctgaaaatcgttttggaatcagtgaccacattgattcatcacct
gtcacagtcaatctcccatatacaattcctgatgcacctccaacaccatgggtatctggt
gtcactagagaaagtattactgttaattggaaggagccttcctctaatggaggaagccat
gtgtttggataccatcttcaaatgaaagacaagaacagtattatgtggaagaagttcaac
aaaactgtgatccgtgccacacattgcaaagtgacaaatgtcagtcctggcctcatctat
gagttcaaggttgcagcagaaaatgcagctggcactggtccattcagcaaaatttcagat
gctgttctggcaattgatgcatgtgaacctccaactgatgttcgtgtcactgatatcaca
aagagttcaatcagccttgcctggcagaaaccatcatatgatggaggcagcaagctgact
gggtacatcattgagaaaaaagatagtccaaaagacagatggtcaaaagttaatctgacc
aatgtttcagacaccaagttcactgtgtcaggtctgacacaagatgaatcttatgaattt
agagtattagccaagaatgcagttggctccatcagtaacccttcagctattgttggccca
gttacatgtgtggatacctatggtgcccctgaaattgaacttcctcaggaatatcttgat
gtgctaaaatacaaagcaggagaggcagttcagctgaaagttggtattattgctaaacct
catccaactattgaatggtacaaagagggaaaagagctggagtctggagctcagataata
atttcaaatgccgctgattctacgtgcatatcagtcaaggatgccacacgtttgaacact
ggaacatatgaactgaaggtcaggaactccttgggctcagcttatgctgccattagagta
ctcattcaagacaaacctggaccccctgtgggagagattcagtttaagaaaattacagca
gacactataaccatcatgtgggatcctccagctgatgagggtggtgcaatggtcacccac
tacattgtggaaaaacgtgagagtagcagaattatgtggtccgtaatctctgagaaactg
gaggactgcattgtgtctgttccaagactgatcaaaggcaatgagtacatcttccgtgtc
cgtggggtgaataaatatggcattggagatcctttagaatctgagcctgttgttgcgcaa
aatgcctttgtacctccaagtcaaccatccaaacctcaggtcactatgatcacacgatca
acaatgactgtggtatgggaacggccaagccttgatggtggcagtgatattgatggatac
tatctggagaaaagagaaaagaagagtcttcaatggttcaaggttattaaagatccgatt
cgtgatactaggcagaaagtcagcagtctcactgagggaaatgaatatcagtatcgtgtc
tgtgcaattaataaagctggaacaggtcaatactctgatgcatccatcttctatagagca
catgatcctattgatccaccaagtgaaccaacaaaacttaaagttgttgattcaactaag
acatcaattacccttggatgggtgaaacctgtatatgatggtggcagtgagatcactagc
tatgtagttgagcagatgaaggctgatgacaaagaatgggttactattagctctaaaggt
gaagtaagaaccactgagtatgtggtgtcccatttgaaacctggagtgtactactattta
cgcgtttctgctgttaactgtgctggaactggacgtgcaattgaaatgattcagccagta
caagcaaaggatattttagaggaagctgatgttgatcttgatatttcaatgtcaactcag
tatacagtaaaggctggaagagatgtggaaataatgattcctctcaagggcagaccagca
cccaatgttacatggaggaggggagacaggaatattagtggtgatgcgaaatataccatt
aataacacagaatattcaacaacacttatcattccaaaggtcactcgggatgattcaggc
aaataccttcttgaaattgaaaatggagttggtgagccaaaaacaatttctatatctgta
aaggtattagactcaccatctgcttgcaataagttggctgtgaaaaatgtaacacgtgga
aaactcactctgagctgggaacctcctcttatcgatggtggtgctccaattaccaattat
ataattgagaagaaggatgctaaaatgaaggcttattctatagttacagcagaatgttcc
aacacatcatacaaggtcgaaggtctctctgaagagatagcttacttcttccgggtatct
gctgaaaatgaaaatggtattggtgatacttgtgaaacctctgaacctgttagagcaact
gagactcctggtgctgtaaagaaccttgtcatgtttgactcaactaacacgtcggtatct
ttggcttggacaaagcctgatcatgatggtggcagccacatttctgaatatatcattgaa
aagaaaacaaaagaggaggatacatggagtgtttgtggcacctgcagatgcttcaagtat
gagctaacacatcttaaagaactctctgaggttttcttcagagtgtatgccaaaaatgag
aaaggtcgcagtgacttctctcaaattggacctattactgtgaaggaattcctcatccca
cctgaggctaaccttattgactaccctagtggtgaattaagtgtccgcattggacaaaat
gtgaacattgagttaccatacaaaggcaaacccaaaccaacaattcagtggatgaaagat
gatttcccactgaaggaaagtgaacaaattcgctttagacaaacagacaataaagctagt
ctgattgtgagaaacacaggaaaggagaatgctggaaaatataccttagttcttgacaat
aaacttgtcaagaacttctttgacatcaaggttatcactcttgggccaccatctgcacca
gtgggccccatccagtttgatgaaatcaaagctcagagcatcattatttcatggaatgtg
ccacaggaagatggtggtggagaaatcacctgctacagtgtggagaaacgtgagacttct
caagcagcttggaaaatggtttgttcaagtgtggtcaggaccacattcaaaatacccaac
ttagttaagggcactgagtatcaattcagagtgcgtgcagagaacaaatatggagtgagc
gagcctctaacctcatcagatgttgttgcccagcaccaatacaagccaccaggcccacca
ggaaagcctgtcgtatttaacgttacaagtgatggcatgacagtttcatgggatgctcca
agctttgatggtggttctccagttaccggctaccatcttgagaagaaagacagaaacagc
cttctttggatgaaagtgaattccactgtcatctctggcagagaatacagagtgattggt
ctcattgaaggcctggaatattcattcagagtgtatgctcagaacaatgctgggatgagt
ccagttagtgaacaaagcaagcacaaacttgcaatttctcctgttgatcctcctggcaca
cctaattgtattgatgttacaagagattccgtcacactccagtgggaaccacccaaacgt
gatggaggcagtaagattgtggcatacagtgttgagaggcgccaaggaagagctcgctgg
ctaagatgcaattttattgatattagtgaatgccagttcacagtaacaggccttgcttgt
ggtgatcgctttgaattcagagtaattgccaggaatgctgttggaacggtcagtccacca
tcacagtcatctggctacattatgaccaaggatgaaagtgttattcctgagattcggttc
agtgctgaaaaaactctgaccatcaaggctggagaaaacatcaagctgagttgcaatatt
agtgggcgacctgtacctcaagttacatggtataaggatggaaaagaacttgataaaatg
cttgttgatattacaactgtcattggatcaagctcattgttcattagagatgctgatcgt
gaaaatcgtggagtttacaccattgaagccaagaatagctctggaacaaagaaagaggat
gttcttgtcagagttcaagatacccctggtccacccgagggcccacttcgctttacaaat
atctctgctgacaaggcaagtctttggtggagtcctccagaaaatgatggatgtgcagct
atcacgcattatgtgattgaaaagcgtgaaacctcacgcattacctgggcacttgttaca
tccaagtgtgaagattgctctttcacaaccacaagcttgattaagggcaatgaatatcag
ttccgtgtttctgctgtcaacaagtttggtgttggtaaaccactggaatctgattcaatt
gttgctaaaatgcaatacactgtaccagatgctccaggtacacctgactgcactcatgtg
acaggaaacagcatcaccctatgctggacaagaccaagatttgatggtggaaatgagatc
aagcactatatacttgaaagaagagagaagaaaagcttaagatgggtaaaggtttcagca
aagagaccaatcactgagctcaggcacagagttacaaacttgactgaaggaaatgaatat
gaattccatgttatggctgaaaatggtgctggtgttggacctccaagtggcacctccaga
ttatttaagtgcagagaacctacaagtgtgcctagtgcaccaacagtggtgaaagtaatt
gactcaacaaagacatctgttacactggaatggaccaaacctgtctttgatggtggtttg
cctatcattggttacatgattgaaatgtgcaaggcaagccttgaggaatggcacagagtt
aacagccagacttgtctccatacccagtacacagttatagaattggagccaggggaagag
tacaaattccgtgtatgtgctgtcaatggtgccggaaagggagagacaactgagattcca
aatgcagtgcaagcagttgacagactaacatcaccagagattgacattggtgcagatttc
aaacagacacatgttgtgaggagtggaggaacagttactctccacattcctttccgtgga
aaacctgctcctctagctacatggacaaaggcagatggagaccttggtgtgatggtggat
attaatacaacagacacattcagcactttgacaattgaaaattgcactagatatgatgca
ggcaaatacacactttctcttgaaaacaacagtggtcgtaaatctattacattaacagta
aaagtactggacacacctggaccaccaggtcctctgtcatttaaggatgtgacaagagga
gctctgacgctcatgtgggatgctccatccagtgatggaggttcccgcattcatcattac
attgtcgagaaacgggaggcaagtcgactgacttggcaagaagtcagtctcaagtgtact
cgtcagattctcagggtgactaaccttgatactggtgtagcatacgttttcagagtcata
gctgaaaatcagtatggtcaaggtgagccttatgaaatgtcggagccaattattgccact
gaagaacctgcaccacctaaaagactggatattattgatactacatcttcaacagctacc
ttagtatggatgaaacctgaacatgatggtggaagtcgaatcacaggctacattgttgaa
accagaaagaaaggttctgatcactgggttgttggtggtcaaactaagtctttgaagatg
attcttgaaggattggttgaaaacacagaatatgaattccgtgtcaaggcccagaatgac
actggagtcagttatccaagagatgctctcacttctgtcattatcaaagaacctcgcatt
gagccaactgctgaccttagtggcatcaacaaacaacttattacctgtaaaactggtaat
tcctttactattgatatccctattagtggtagaccagctccaaaagtaacatggaagctt
gaggagatgaaactcaaggaaaccgatagggtttccatcaaaacgaccaaagacagaact
acgttgttggttaaagatgccaagagaggtgacagtggaaagtattacctgactctggag
aatgctgcgggggcaaagacattcaccatcactgtaattgtctttggaagacctagccca
ccaagtggtccatttgaaatttcaggagtaacctcagagtcctgtgtgttgacatggtca
gagcctactgatgatggtggaacagacatcactaactatatagttgagaaacgtgaatct
ggtcaaacctcttggcaggttgtgaactcaagcgtgaaacgcccaaccatcaaagtgaca
catttgacgaaatacatggaatatactttccgtgtctgtgcagagaacaagtttggtgtt
agtaagccaattgagtcagaagccattgttgctgaacatccattcatcccaccaagtcca
ccaactcgtccagatgtggtgtctgtatctgctaatgccatttctattaaatgggatgtg
ccgtatcatgatggtggaagcaaggtgactggatattggattgaaaagaaagagcgtaac
accattttatgggtgcgggaaaacaagatcccataccttgagtgtcactacaaggtctcc
agtcttattgaaggacttgaatatcagttcagagtgtatgcaatgaacattgcaggtctt
agcaaagccagtgaagcttcaagaccagtgctggctttgaatcctgttgacccacctggt
aaaccagaggtttatgacattacaagatcctcagtttctatcagatggtctgaaccactt
aatgatggtggcagcaagattgttggctatgtagttgaacgcaaggcatcctcagatgat
gatgaaactcgctggttgaagtgtaactacactactattacagacaacttctttataata
acatctcttgaagagggagtggtgtatgaattccgtgtcattgccagaaatggtgcaggc
gtccatagtatgccatctgaatcaacaggattcgttacatgcaaagatgaatacacacca
ccaaaggctgagttagacagcaagcttgtgggtgaaatagtcactattagggctggatct
gacctcgttcttgatgctgcaattggtggtaaacctgagcccaaggtcttctggtccaag
ggtgagaaggagttggagcttggtgacaaatactcactaacatacaccagcacaagagct
atggcaatcatcaaatcatgtgacagaaatgatactggaaaatatatattgactgttaag
aatgccagtggaaccaaggtggcagctgtcagtgttaaagtccttgatacccctggacct
ccagagggtaaaatcacaatcagcagggtcacagaggaaaaatgcacagtttcttggaaa
atgcccattgaggatggaggagacactgtcactcattacattgtggacaggcgtgagacc
agtagactcaattgggttgtgatggaaactgaatgcaagaccctgtcttgtgttagcaca
aaactcattaagaacaatgaatatatcttccgtgtcagaggtgttaataaatatggacct
ggtgtaccactggagtctgaaccagttattgcaagaaatgcatatatgatcccaacaccg
cctggtgcaccagaaattgctgctgctggaaagcaacatgtcatcattgaatggctgaag
ccagagagtgatggtggaagtgaaatcaaaaactaccttgtggataaacgcgagaagagt
agtgtgagatggacaagagtgaacaaaactttcacaatctatgacacaagactcaagatt
atgggtctcttagaaggaagtgaataccaattccgtgttgcagctgttaatgctgctggc
actagcttaccaagtgatgcatctgaatatgtcctttgcagggagccaacatatacccct
gctcctccatcaattcctcgtataacagattctaccaaacacagcctaacaatgtcatgg
accagacctatgtatgacggtggttcagatgtcacgggctatgtaattgagattctggag
gagggaactgaacagtggtatagagccactcagaagattctgaccaccactgagtatact
gcagctggtctgacaagcaacaaaaaatatagcttcagagtagctgcagtgaatgcaatg
ggcacaggagagttcagtcaagggactgtggagactgcaccttcagagagaattgaaatt
cctgatattgaattacctgaagatctgaagaagacagtttgcctgagggctggtagcact
ctgcatctaaatgcactcatacttggaagaccaatgccagttgttacttggagaaaaact
ggcattgacctccagtcccgtggatacattgacacaacagaaagcaccaccgttttgaca
gtggagaaggtgcaccgttatgatgccggcaaatacacaattgaggcagaaaatccatct
ggaaagaagactgttacaattcttgtcaagatttatgatactcctggaccctgtggtgca
gtcaaagtcaaagattacactaaagaatcggttgtcattacatgggatgttcccactgtt
gatggaggggctcctataaacaactacattattgaaaagcgtgaagcatcaatgaaatct
tacaaaaccgtgacaaatgaatgcaagaagaccttgtatagaattactggattagaggaa
ggaattcgatacttctttagagtgttgcctgagaacatatatggtattggagaaccttgt
gaaatcagtgattcagtattggtatgtgaagttccatctgttcctcaagatttgcaagtg
attgatgttacaaagtccactgttactcttggatgggagaaaccacttcacgatggaggc
agcagacttactaactacattattgaagcatgcaagacaggaacagacagatggattaat
attgctaatgtgaaggcatcagcgtcacagcatacaatagcttctctgaatgagaatgag
caatatatgttcagaatcagagcagagaataccagaggccttagtgagcccagagacctg
atgtcacctgtaactattcaagaacagagagttatgccgaagattgatctggctggtatg
ccactaaagatcatcaatgtgcccgctggtaggccaattgtgcttgacattccaatcaaa
ggaagaccaccaccaacttgctcatggttctttggaggtgttaagatgaaggacacactt
gaccgtatcaagattgagacaactgtcaaatacactaaactgacagttcgtgaaaccaca
attgacgacactggtgattatacactagaagtaaagaatgacatgggaatagctacagaa
atcattaaagtcatcattcttgataaacctggggtgcctgttggacctatgagaattgat
gaagttgatgcaacatctgttacatgtagctggaatgcaccagaaaaggatggaggtgcc
aatataagtggttatgttgttgagcagcgtgatgctcatcgtcctggatggttgcctatt
tctgaatctgtcacaaggcttgcattcaaattcagtagactgactgaaggaatggaatat
gtgttccgtgtggctgcaacaaatcgctttggcgttggtgcattccttcaatctgaagtt
gttgagtgcaagagtgccaaaactattcctaatgcaccaagcatacctgaaatatttgat
gtgtctcatgatggcatgacacttacatggagaccaccagaagatgatggtggttcttca
atcgctggctatatcattgagcgtaaagaagctggatctgacagatgggtgcgcattaat
aaaaatccagtgacaatgacaagatacagatcaacaggacttgttgaaggtcttgaatat
gagtacagagtaacagctattaattctagaggcactggcaaaccaagtttgagctctaaa
ccagtgattgcaatggatcctatcgaacctcctgggataccactgaatccaagagtcaca
gataccaccaggacatctgtgtcactggcatggtctcccccagaagaagaaggaggtgcc
accattattggttacctgattgagatgcagaaggttgaccaggtcgaatggaccaaatgc
aatacaacaccaacaaaaatttgtgaatacacactaacacatatgccacagggtgctgag
tacagattccgtgtgatggcgtgcaatgctggtggacctggagaaccagctgaaatacca
ggagtgattaaggtcacagaaatgcttgaatatcctgattatgagctggataagaaatat
caagagggctatattgtcagacaaggtggagtcatcatactctctgtgccaattaaggga
aaaccatatccaatatgtaagtggacaaaagaagggcgagacatttctcacagagctatg
attgccaccggtgaggaccgcacagagctgatgatcagggaagcccacagagatgacact
ggcacttatgatcttgtgttggagaacaaatgtggaaagaaagctgtgtacatcaaagtc
aaagttattggacgcccagatccacctgaaggtcctctggaatttgacgatattcaagca
cgttctgtaagagtcagctggagaccaccttcagatgatggtggcgctgatgtccttggg
tacattgtggagagacgtgaggtaccaaaggcagcctggtacactgtggactctcgtgtg
gttgacacatcactggtggtcaagggattaaaggaaaatgttgaataccacttcagagtt
tcagcagagaatcagttcggaattagtagatctctgaaatctgatgaatcagttatgccc
aagacccctctctgtccaccagagcctcccagcttccctccagaaattatggatgtcaca
aaaacaagtattggtctatcttggtcaaggccaaaggatgatggtggttcacgggtcact
ggatactacgtcgagagaagagagttgtccactgagaagtgggtgcgtcacaacaagact
catatcacgacaacaatgtatactctcactggtcttatccctgatgcacaatatcagttc
cgcgtggtcgctcagaatgatgttggtgaaagtgagcctggaccagtatctgaagcaatt
gtatgcaaagatccatttgataaaccaagtcaaccaggtgacattgacatcatttccatt
accaaggatagcattaccattcactggctacgccctgaattggatggtggcaaagaaatc
ctaggatattggattgagttcagacaagcaggtgaaagtgcctggaaaaaatgcaacaag
gagcgttcaaaagacaggcaattcaccatgggtggtctcatggaggcaacagaatatgaa
tttagagtgtttgctgaaaatgaaactggactgagtagacctcgtagaactgccatgggt
attaaaaccaaactgagcgttggagaagcaccaagtctgaaagaagagatgaaagacaac
accacaaatctgggagaatctggaacattatcttgccagattattggaagacctcttcct
gaaattaagtggtatagatatggaaaggaactgatgcagagtcgcaaatacaagatgagc
tctgatggtagaaatcattctctaacagtattaacagatgagcaagaagatgaaggtctg
tacacttgcagagccattaatgacgctggtgaggttgaaaccagtggcaagctctttttg
caggctgcaccccaattccatcctggatttccattaaaggagaaatactatgcaggatgt
ggaacaagtctacgcctccatgttgtctacattggacggcctatcccacaaatcatgtgg
ttctatggaaagaaacccctgaaaccatcagaggatataattattgaaaacacagacaat
tacacccatctagttgtcaggaacgtgcagcgcaagacgaatgctggcaagtacaaggtt
cagatgagcaataaatttggtacaatcgaaacagtgcttcgtgttgaaatccaagataaa
cctctgatgcctgaaggaccaattgttgtcgaagctctcctaaagaactctgtaatcatt
agttggaagccacctaaggacgatggtggctcactgattacaaattacattgtagaaaaa
cgagaggcaaaggagggcgagcaatggcatcttgtatcatcatctgtctcaggaactact
tgccgtgttctaaatctaattgagagtgccggatattacttccgtgtttctgcacagaat
caatatggtattagtgagtcactggagattccagctgttcttattatcaagagtccattt
gaaaaaccaggtatcccacaccagccagttgttacttctgtctcaaaggattcatgtgtt
gtgacatggaaacctccatccagtgatggcggtgccaagattaagagttactatattgaa
aagagagagaagaaacagaacaaatggattgctgttacaactgaggaaattcatgagaca
cactatacagttaaaggcctgattgaaggctttgaatatgaattccgtgtcaaatgtgag
aacattggcggagagagtgattggagtgaaatttcagaaccggtcattccaaagtctgac
acagctccccgtgctccattcttcaaggaggaactgagagacatgtgtgtaaaatacagg
gccaatgcaacctttgtcactaaggttattggatatcctaagccggtggttaaatggtac
aagggtggcaaagaaattttaccagatggtgaaaagatcaagatccaggaattcaaggga
ggctaccaccaacttgttatcagtaatgctgatgagaatgatgtagctgtttaccaaatc
agagccactaatcaggaaggatcaatctctacaactgtaacccttgatgttgaagttcct
gccaaggttcatttaccactacatctccaaggtatgggagctgttcatgctcttcggggt
gagatggttaccatcaagattccaatcagtggtaaaccagatcctgcaataacatggcag
aaaggacaagagatactgagtaacacatcataccatcaagtaattgttacaagatccttc
acatcccttgtgttcctaaagggagtacaaagaaaggatgctgggtactatataatttgt
gccaagaaccggtttggcgttgataagcagacagttgaacttgatgttgctgatgtaccc
gaatcacctaaagatgttaaagttagtgacattggcagagatactatcacactcacatgg
actcctccaaataatggtggaagtgaaattactagctacattatagagaagtgcccagtc
tctggtgacagatggatacgtgttgcccagacatctgaggcacaatatactgtgatgagt
ttatttggaaagaccaaataccagttccgtgttattgctgaaaatcaatttggattcagt
cacccatctgtaccaactgagcctgtgacaacaagggaagacaaatatgctattagaaac
tatgatgaagaagtggatgaagcaagagaggttacaaaggaggaagcaccacattctaag
gttaagaatgtgccttctctttacaaaatatcagaggaacttgcacggtgtggacacttt
ggaattgttcatcgctgtgttgagattagctccaagaagacattcttggctaagatgata
aaggtgaaaggtgcagatagagagctggttgcaagagaaattgagacactgaatattgca
agacacaagaacctattgtatcttcatgaatcctttgatagcttggaggaatatgttctg
atctatgaattcatatcaggcatggacatctttgagcgtcttggaacaacttttgacctc
actgagcaagaaattgttcggtacatgaggcaagtttgtcaggctctcaagtttttgcat
ggcctcaactatggccattttgatataagacctgataacattgtatatgccacaaggaag
agcagtacagtcaagataattgaaatgggccaggcaaggctgttgacacctggagaaaat
atcagaattcagttcactgccccagaatactgtgcacctgaaatacacaacagtgatttt
gttaccactgctactgacatgtggtcagttggagttcttgcatatgttcttctcagtggt
atcaatccattcgcagctgaatcatctctaaaaatgattgaacacatctccaatgcagaa
tacatatttgatagtgaagcattcaaagagattagtactgagggaatggactttattgac
aggctgctgactaaagaatgcaaacatcgcatgactgcatccgaggctttggagcatcct
tggctcaagatgaaaatcgaaaacatcagttctaaggttataaagactttgagacacaga
cgatactaccagtcacttgtcaagaaggagtggagcactgtcatttcggcagctcgtgtt
gcctatggtggtgggtacagaaaccagaggaatgtttcatttggcagagtgaaaattgga
cccccagagcaaggcctaagagcaggtccagttatgcatggttctgctgaagaaggtggt
catgtccgatttatgtgcaacattgagaactatgacagaaacacacaggtgacctggtac
tttggctctcataaattgacagctagtcataagtatgaaatcaactatgccaatggaatt
gcaagcatctatgtaaaagacattgaggaacgtgatgatggactatacagatgccatgtt
gttagtgaagacagggaagacaatgcctatgcagagctatttgttgagagtgtgaggtcc
tatcgtgagtacttccttggacgttcacttaagaagcttaagcgtagaattgacaaaacc
aaacttcttcaaaggcctcctgagtttactctgccactgtacaaccgtacagcatacatt
ggtgaggatgtacgctttggtgtaactataactgtccacccagagccacaagtaacatgg
ctaaaagcaggacacagaatcaaacctgatccagagaaatacacatttacaagggacaaa
ggtctttatcagctaatgattcacaatgttgagcttgaggacgatagtgaatacactgtg
gtagcaaacaacaggtttggtgaagacagttgcaaagcacgtctaaccataaaatctcat
gctgttgttgaagacacaatgagaccaatgtttaaacgcctcttggcaaatattgactgt
gttgagggacaaagtgtccacttcgatttgagagtgtcgggaattccaccaccaactctg
aaatgggaaaaagatggcaagcttcttgaattcagaccacaagttgaagttgttcaacaa
gatagtgactactatgttctccatattagagaaacacttattgaggactctggcatttat
agagtcactgctactaactcagctggttcagcaagttgccaagcaacactcaaggttgaa
cgtctaacttatacaaggagagaattcaagagtgagggagaaaagcagatatatgtacaa
aatcaaattgagaaaacactgaaaatggcacaagagttctcagcaacagaaatgaccata
cttaatcctgcagcacaagaggcactaaaagaagctgctgaactgtacaagcctgccgtg
agcacaaagcatgtgcagggagaatttgacatctctgacaaagaagatagagaaataaag
aaaattaaggaggaaggcaggaaaattagaatgccttatgaaattccagatgctcgtgta
catgatccaaccgtttttgaagaggacatgggtatcaaacactttgtgcctttatctgac
atgaagtggtataagaaactctgtgaccaatatgagattcctgaacgcatggagagagtt
gtgcagaaaagacagaaacgtatccgtctttcaagatgggagcaattctatgttatgcca
ctccctagaattacagatcagtacaggccaaggtggcatattccaaagcttactctagat
gatctagaaactgtaagaccagcaaggcgctcaccatcaccagagtcagaagtctccttc
aaactaagaagacgttctctaggtgatctttcagatgaggagatcatccagcctgtagag
gactacttgacaaagagaagaattgaagaagagaagcaaaagctggaggaagagcttgaa
cttggattctccgcctcccctcctagtggaagtcctgtccactttgaactgtcagcactg
cgccgtccatcacccagggttgtccacaaagctgaagtaaaacatgtagaggaaaccaaa
cacgtattaatggcagagaaacatcatggttctccaccacccatttcccatttcataagg
aggcggagatctctatctccaacatatatcgaactgatgcgcccggtctctgaactgatc
agaccaccgcgtgtacgtgtgccagtggaagctgaggaaggtgagataatagagaggagg
tcacctactcctgaaaggacacgtccacggtctcctagtccaatatctcctgacaggagg
tcttcaaggtcctcttcaagatttgaaagatctgcacgatttgacatcatgtctagatat
gaggcaagaaaagctgctctaaaatctgagcggaagtatcaggttgtgacacagcaaccc
ttcagtcttgaccatgcaccacgtatcacagttagaatgcgctcacaccgtgtcccaagt
ggtcaagacactaaattcactatgaatgtccaagcgaagccagaatgtgaaattcagtgg
tttcataatggacaagtgattcatgagagcaacaaatatcgctttacaaacatgagcggt
gtgctgactctccatattactgattgtcaagcagaggatagtggcacatatcgtgttgtc
tgcacaaacgccaagggagaagcatcggattatggaactcttgatgtatcaggaggagca
tttacaacatactcctcaagacgcagagatgaggaggctccaacgctatttgtacctgaa
ctgacaaagactgattattaccacacaacaacaatcagggcctcttctgcctcaagaaca
cacttagaaatcaaagaaagcaagacgaaaattactgagatacatgaagcttctgcaagt
gaaaaatatgagtctgaaaggcttgcatcatcacctatcagacattcatcaactgaatac
ctatcatctacttcatattcttccttagaacgatatacatcattggaatctaagtcaaga
attgattctacatctacaacagcagtaactactaagaaagtcaaagccactctttcagcc
caaatactcaccaaaccacagtctctaatagtatctgtgggtgaatttgcaaaatttacc
tgtgacattgatggagagccagcgtcaagtgttacatggatgcatgagggacgtattgtt
atcacttcccatcgtgtacaagtgacaacaacacagtacaagtctacatttgaaatatct
tcagtagacttttcagatgaaggaagctactctgtagtggttgaaaattcagagggaagg
caagaggcaaagtttaccttgaccatttacaaaccagcaccaaaagaaaaggttgttgca
ccctcccaagtcaaacctcctgaggcagcagtgaaattacctgagccttctgcaaaaacc
ccagtacctgtgaagtcaccagaacctttggcaaaatctcctgcaccttctgtcacatct
tcagttaagtctccagagccatcagtcatatccccagtaccatcagttaagtttccagag
ccttccatgaagtcaccagaacccactggtgttaagtcccctgaaactgagatcaaatca
cctgagggtgtcaaatctccaataagggtaaagtctcctgagccagggactgttggcccc
agagtcaggtccccactcccagtcaaatcccctgaagtcaagtctcctccaagagtgaag
tctccagaactaattacctcccctctgaaagttaaatctcccacaggcctgaagtctcct
gaaccaatagcttcccctccaagagtgaaatctccaactccagttaagtctccagagcca
acatccccacctcaaagagttaaatctccaacaggcacaaaatctcctgaaccaattagt
tctccactgagggtaaaatcaccattaggcatgaaatcacctgagccatccacctctctt
caaagggtgaaaaccccaccaatggccaagtctcctgagccattaacatcacccaaaagg
gttaaatctcctcttactgtgaaatcaccaccaaagattctccagcaacttaaagctgag
gcatctgaagataaggtgaagatgatttgtgttgctgacagctctgtgagagaggttttg
tggtataaagatagcaggaaactgagccagagtaatcactatcagatccatacagctgct
gatggcacatgctgtctttatatatctgatctgtctgagaatgataagggtgaatattcc
tgtgaaatgactggagaaggtggagcagtctcaagaacatcattctcatttgttggtcaa
gtgttccaatcaatctctaaaaaagtaacgacttttgtgtctacacgtatggctgtgaaa
gaatcagtgtcctccaagacccaagagggggctgaagtgctaatgaaggagagtgctgct
gtcagcagcatgcaagaaagtttctcttcaaaatctatccacatggaaagtactatgcaa
gagacatcatttagcagttccaccatggctgaaatgaaatttgaaacaatgtccatgtcc
agcatgtcctccatgacttctgaatcggcgtatgctatgagctcaagcagcatgatgtca
agtcattcacaggccgagggaaccacagtaagagccattttgcatagcggtcaaggttca
gctccaagaattgaagccctccctgaagacatcagtattgaaactggaaaggttttgaca
gtagcatgtgctttctctggcgagccttcacctcacattgagtggtcccgtggaggaaag
acacttccaactgctgaagagagtggaaggttccacattgagacaactgaggatctcacc
acactcatcatcactggtgtaaaacagagtgatgctggcttgtacaccctcaaactttcc
aatgagcatggatctgacatggcaacagtcaccatcaacattcgatcactgtaa

DBGET integrated database retrieval system