KEGG   Electrophorus electricus (electric eel): 113584823Help
Entry
113584823         CDS       T05787                                 

Definition
(RefSeq) glutathione hydrolase 5 proenzyme-like
  KO
K18592  gamma-glutamyltranspeptidase / glutathione hydrolase / leukotriene-C4 hydrolase [EC:2.3.2.2 3.4.19.13 3.4.19.14]
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee00430  Taurine and hypotaurine metabolism
eee00480  Glutathione metabolism
eee00590  Arachidonic acid metabolism
eee01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eee00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    113584823
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    113584823
   00480 Glutathione metabolism
    113584823
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:eee01002]
    113584823
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:eee04090]
    113584823
Enzymes [BR:eee01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     113584823
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     113584823
    3.4.19.14  leukotriene-C4 hydrolase
     113584823
Peptidases and inhibitors [BR:eee01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   113584823
CD molecules [BR:eee04090]
 Proteins
  113584823
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G_glu_transpept Sarcolipin
Motif
Other DBs
NCBI-GeneID: 113584823
NCBI-ProteinID: XP_026877798
Position
Unknown
AA seq 468 aa AA seqDB search
MARRKERVCMCFSVVLICVIIIIIIIICLTHFPEQDCPGGEFRKAAVAADSDTCSKVGSR
VLQSGGSAVDGAIAALLCTSVINPQSTGIGGGSIFTIMESNGKVKIINSRETAPNRVKPD
LLSACSSEGSGSQWIGVPGEIRGYEKAHRLYGRLPWADLFQPTIQLAREGIPISIILQHC
LHIPNNTSSPLRQLFMDAEGNMLKQGDTVKFERLADTLEMIAKYGADVFYTGDIAKDLIS
DIQEAGGTLTLEDLSSFTVSEPQAWNASVGDYTMYFPPPPSGGATLSFILKVMQGYNLSP
ASVQGEERVHTFHRYVEACKFANGLRKLMKDPAFGSQMEASAMIQEKFAQYIRGLISSNS
TYKAVYYNITPHVDTQGTSHVSVLAEDGMAVSVTSTINHLFGSKVLSPKTGVILNNQLFD
FCGKVNQIHPGERPPSSMAPVVLASSAKKHTVIIGASGGSMITTGISM
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggccaggcgaaaggagcgtgtttgcatgtgttttagcgtcgtgctgatatgtgttata
attataattataattataatttgcctgacacactttcctgagcaggactgtcctggtgga
gagttcaggaaagctgcagtagctgctgactcagacacgtgttcgaaggtcgggagtcgt
gttctgcagtctggaggctcagcggtagatggcgccatagccgccctgttatgtacctcc
gtaataaacccgcagagtacgggaatcggcggagggtctattttcaccatcatggagagc
aacggtaaagtgaaaatcatcaattccagggagactgctccgaacagggtcaaaccagac
ctgctatcagcgtgttccagtgagggctcaggtagtcagtggatcggcgttcctggtgag
atccgtgggtatgagaaagctcacaggctgtatggccgcctgccctgggcggacctgttt
cagcccaccatacagctggccagagagggcattcccatctctataatcctccagcactgc
cttcacattcctaacaacacgtcttcacccctgaggcagttattcatggatgctgagggc
aacatgctaaagcagggagacactgtgaagtttgagagactggcagacactctggagatg
atagccaagtatggcgcagatgtcttctacacaggagacatagccaaggatctcatcagt
gacatccaggaagcaggtgggactcttacgctggaggacctgagctcgttcacagtgtct
gagccgcaggcctggaatgcatctgtgggagactataccatgtacttccctcctcctcca
tcagggggcgccactctcagcttcatcctcaaagtcatgcaaggctataacctcagcccg
gcgtctgtgcagggagaggagcgggttcataccttccatcgctatgtagaggcttgtaaa
tttgccaatggcctgaggaagttgatgaaggaccctgcatttggctcccagatggaggca
tctgctatgatccaggagaagtttgcccaatacattcgaggactgatcagtagtaactct
acctacaaggctgtttactacaacatcacaccccacgtggacacgcaaggcacaagtcac
gtatccgtgctggcagaggatggtatggccgtgtctgtcaccagcaccatcaaccacctc
tttgggtccaaagtgctctctcctaaaacaggcgtcattcttaacaaccaactctttgat
ttctgtgggaaagtgaaccaaatccacccaggtgagcgtcctccctcctctatggcacca
gtggtccttgcctcctctgctaaaaaacacactgtgattattggagcttcgggaggcagt
atgatcaccacaggcatttccatg

DBGET integrated database retrieval system