KEGG   Electrophorus electricus (electric eel): 113586015Help
Entry
113586015         CDS       T05787                                 

Gene name
dpp3
Definition
(RefSeq) dipeptidyl peptidase 3 isoform X1
  KO
K01277  dipeptidyl-peptidase III [EC:3.4.14.4]
Organism
eee  Electrophorus electricus (electric eel)
Brite
KEGG Orthology (KO) [BR:eee00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:eee01002]
    113586015 (dpp3)
Enzymes [BR:eee01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.4  dipeptidyl-peptidase III
     113586015 (dpp3)
Peptidases [BR:eee01002]
 Metallo Peptidases
  Family M49: dipeptidyl-peptidase III family
   113586015 (dpp3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M49
Motif
Other DBs
NCBI-GeneID: 113586015
NCBI-ProteinID: XP_026879654
Position
Unknown
AA seq 726 aa AA seqDB search
MVDSQYYLPNDIGIAALDCGEAFKLLSPKEKLYAHYLSRAAWYGGLVVLLQTSPESPYVY
VLLQRLFRKQAPAQLEAVADAAGLSSEEYQAFLVYAAGLYANMGNYKSFGDTKFIPNLPK
EKFKALVWNSQAYKESPGEMEALWNNCSHLLYSLEDKQKQLGLGDKGVTTYFSGNCCLED
AELAQKFLDSKKLSAYNTRLFKKESAGKHCYEVRLASAVKKDCGVEGEGETRCGTYDFDE
AVFSVQRGDYAFLMEKVSQNLEKAKAYAASDNQKGMLEEYIRSFTYGSVDAHKEGSRFWI
KDKGPIVESYIGFIESYRDPFGSRGEFEGFVAVVNKAMSARFAELVSSAEVLLPELPWPP
AFEKDHFLKPDFTSLDVLTFAGSGIPAGINIPNYDDIRQTEGFKNVSLGNVLAVAYATQK
EKLTFLEEKDKDLYIKWKGPSFEVQVGLHELLGHGSGKLFIQDEKGKLNFDKAEVRNPET
GELISSWYKGSETWDSKFSTIASSYEECRAECVGLYLCLNKQVLSIFGHEGEEAEEVVYV
NWLNMVRAGLLGLEFYTPESKSWRQAHMQARFVILRVLLEAGEGLVTLCESSGADGRPDA
LITLDRSNIHTVGKRAMQKFLCKLQVHKSTADVEGGRALYETYSAVTSDGSHDFLRLRET
VLLRKEARKMFVQANTLLKGETVELEEYEATAAGLIQSFTQRFTEDAEKLEAQLLELVSI
DAPCWC
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atggtggattctcagtactacctgccaaatgacattgggatcgcagccctggattgtgga
gaagccttcaaactgctttctcccaaggagaagttgtatgcacattacctctcaagggcc
gcttggtacggtggtctggtggtgctgctgcagacctctcctgagtctccctatgtctat
gtgctcctgcagagactgttccggaagcaggcccctgcacagttggaggctgtggcagat
gcagcagggctgagctcagaggaataccaggcatttcttgtatatgcagctgggctatac
gcaaacatgggaaactacaagtcatttggtgatacaaagttcatccccaatttaccaaag
gagaagttcaaggccctggtgtggaatagtcaggcctataaggagagcccaggtgagatg
gaggcactgtggaacaactgctctcacctgctctactccctggaagacaagcaaaaacag
cttggtcttggggacaagggagtcactacatatttctcaggaaactgctgtttagaagat
gcagagttggcccagaaatttctagactccaagaaactgagtgcctacaacacccgtctg
tttaagaaggagtcagcagggaagcactgctatgaggtgcgccttgcctctgcagtgaag
aaagactgtggtgtggaaggcgagggagagactcgctgtggcacgtatgactttgacgag
gccgtattctctgttcagagaggagattatgcatttcttatggagaaagtgagccagaac
ttggagaaagctaaggcttatgctgccagtgataaccagaagggcatgctggaggaatat
atccgtagttttacctatggttctgtggatgctcataaagaaggctctcggttttggata
aaagacaaaggacctattgtggagagttacattggctttattgagagctacagagatccg
tttggctcaagaggggagtttgaagggtttgttgctgtggtgaataaggcgatgagtgca
cgctttgctgagctggtaagctcagctgaggttttgctaccagagctgccgtggcctcct
gccttcgagaaggaccacttcctcaaacctgacttcacctccctggatgtgctcaccttt
gctggcagcggcattccagcaggaattaatattccaaactatgatgacatcagacaaact
gaaggctttaagaacgtgtcattggggaatgtgttggctgttgcatacgccacacagaaa
gagaagctcacttttcttgaagaaaaagacaaggatctgtacatcaaatggaagggccct
tcttttgaggtgcaagtggggcttcatgagcttctgggccacggtagtgggaagctcttc
atccaggacgaaaagggaaaactcaactttgataaggctgaggtccgtaatcccgagaca
ggagaactgatatctagctggtacaaaggaagtgagacatgggacagcaaattctccacc
attgcttcctcctatgaggagtgcagggcagagtgtgtgggactctacctctgtcttaac
aagcaagtcctcagtatatttggccatgaaggtgaggaagcagaggaggttgtatatgtc
aactggctgaacatggtccgtgccggtctgctgggcttggagttttacacgccagaaagc
aagagctggagacaggctcatatgcaggctcgctttgtgattctgcgtgtgctgctggaa
gcaggagaggggctagtcaccctttgcgagtcctcgggggcagacggtcgccctgatgcc
ctcatcacactggaccgcagcaatattcacacagtgggcaaacgtgccatgcagaagttc
ctctgcaaactgcaggtgcacaagtccacagctgatgtggagggcggtagggctctctat
gagacttactctgcagtcacgtctgacggttctcacgatttcctacggctaagggagact
gtcctactccgcaaggaagcccgtaagatgttcgtccaggccaacactctgcttaaagga
gagacggtcgaactggaggagtatgaggctactgctgcaggactgatccagtcattcacc
cagcgtttcactgaagatgctgaaaaactggaggctcagctgctggaactggtctccatt
gacgccccctgctggtgctga

DBGET integrated database retrieval system