KEGG   Electrophorus electricus (electric eel): 113586137Help
Entry
113586137         CDS       T05787                                 

Definition
(RefSeq) glutamate receptor 1-like isoform X1
  KO
K05197  glutamate receptor 1
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:eee00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    113586137
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:eee04040]
    113586137
Ion channels [BR:eee04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   113586137
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lig_chan ANF_receptor Lig_chan-Glu_bd SBP_bac_3 Peripla_BP_6 DUF2061
Motif
Other DBs
NCBI-GeneID: 113586137
NCBI-ProteinID: XP_026879868
Position
Unknown
AA seq 907 aa AA seqDB search
MQRSLALLCTGFLGLCFGTSFPSNINIGGLFPTESHEYEVFRFALSHHQDIPKLVPQVDM
VKMGNSFSMTYAFCSQFAKGVYAIIGVYDRKTVNMLMSFCGALHVCFVTPSFPIDTSNQF
VIQLRPELQDALVGVIEHYKWSKFVYMYSSDSGLTVLQKVLDTAAEQNWLVTSVNVETMT
EASFLKVFQDLDKRKEGQIIIDCELERLTSILKKIIELGKNMKSYHYILANLGFLDIDLT
EFKRGEANVTGFQLVNYTDQNISRIRQQWMDFDNKVPKRPLKYTGALTYDGVKVMSTAFQ
NLRRQRIDISRRGNAGECLANPPAPWGQGIDIQRALQQVRIEGLTGHIQFNEKGRRTNYT
VSVMELKATGPKKVGYWNEDEKFVSTSAYFPGSNGTNGLQNRTYIVTTILESPYVMLKKN
HEQLVGNDKYEGYCVELAAEIAKHVGYQYKLKIVADGKYGARDPDTKMWNGMVGELVYGK
ADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPTKSKPGVFSFLDPLAYEIWMCIVF
AYIGVSVVLFLVSRFSPYEWHGDDDDEGVETGSSQLTPAAPGQPGQAQQSQEQTNEFGIF
NSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIE
SAEDLAKQTEIAYGTLDAGSTKEFFRRSKIAVFEKMWSYMKSADPSVFVKTTDEGVMRVR
KSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSPLRIPVNLAVLKHN
EQAVLDKLKNKWWYDKGECGSTDSGRKDKTSALSLSNVAGVFYILIGGLGLAMLVALVEF
CYKSRTESRRMKQSISDAMRCSTLTRMSGNASGGENGRVVTHDFPKAVQTLPCVGHPAGM
GLAASGM
NT seq 2724 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaagcctcgctctgctttgcaccggtttcctgggactgtgctttggtacgagt
ttcccaagtaatatcaacatagggggcctgttccctaccgaatcccacgaatatgaagta
ttccggtttgcgctttcacaccaccaggatattcccaaattggtacctcaagtggatatg
gtgaagatgggaaatagcttttccatgacatacgcgttttgctcacagtttgcaaaaggg
gtctacgccatcatcggcgtgtacgaccggaagacggtgaacatgctgatgtcattctgt
ggcgctttgcacgtctgtttcgtcacgcccagtttccccatcgacacgtccaaccagttt
gtcatccagctacggcccgaactgcaggacgcactggtgggcgtcatcgagcactacaag
tggagcaagtttgtctacatgtatagctccgactcaggactgacagttctgcagaaggtt
ctggatacggcagcggagcagaactggctggtgacctcggtgaatgtggagaccatgaca
gaggcatccttcctcaaagtctttcaggacctggacaagcggaaggaaggacaaatcatc
atcgactgcgaactagagcgcctcacctccatactgaagaagattattgaactggggaag
aacatgaagagttaccactacatactggccaacctggggtttctggacattgacctgacg
gagtttaagagaggcgaggccaacgtgactggcttccagctggtgaactacaccgaccag
aacatcagcagaataagacagcagtggatggacttcgacaacaaagtccccaagaggccg
ttgaagtacacaggggcgctcacatacgatggcgtcaaagtgatgtccacagccttccag
aaccttcgacggcagaggattgacatttcacgccgtggcaacgctggggaatgcctggcc
aatccgccagccccctggggccaaggcatcgacattcagagagccctacagcaggtccgg
atcgagggtttgacggggcacatccagtttaacgagaaaggccgacggaccaactacacc
gtcagcgtgatggagctgaaggccacagggccaaagaaagtggggtactggaacgaggat
gagaagtttgtgagcacgtcggcctacttccccggcagcaacgggacgaacggactccag
aatcgcacctacatcgtcaccaccatcctggagtccccgtacgtaatgctgaagaaaaac
cacgagcagctggtgggcaacgacaaatacgagggatactgtgtggagctggcggccgag
atcgccaagcacgtgggataccagtacaagctcaagatcgtggccgacggcaagtatgga
gcccgggatccggacaccaagatgtggaatgggatggtgggggagctcgtgtacggaaag
gctgacgtcgctgtggcgccgctgacaatcacgctggtgcgggaggaggtgattgacttc
tccaagcccttcatgagcctgggcatctccatcatgatcaagaagcccaccaagtccaag
ccgggcgtgttctccttcctggacccgctggcctacgagatctggatgtgcatcgtgttc
gcctacatcggcgtgagcgtcgtactcttcctggtcagccgcttcagcccctacgagtgg
cacggcgacgatgacgatgagggcgtcgagaccggctccagccagctcacgccggcagct
ccgggccagccgggccaggcacagcagagccaggagcagaccaacgagttcggcatcttc
aacagcctctggttctcgctgggtgcgttcatgcagcaaggctgtgatatctcacccaga
tctctctcaggtcgcattgtcggtggtgtgtggtggttcttcaccctcatcatcatctcc
tcatacacggcgaacctggcggccttcctcaccgtggagaggatggtgtcacccatcgag
agtgcggaagacctggccaagcagacggagatcgcctatggaacgctggacgctggctcc
accaaagagtttttcaggaggtcaaagatcgccgtgttcgagaaaatgtggtcctacatg
aagtcggcagacccctccgtgtttgtgaagaccaccgacgagggtgtgatgagggtgagg
aagtcaaaggggaagtacgcctacctgctggagtccaccatgaacgagtacatcgagcag
cgcaagccctgcgacaccatgaaggtcggagggaacctggactccaagggctacggcgtg
gccacgcccaaaggctcgccgctcagaatccccgtaaacctagcggtgttgaaacacaat
gagcaagccgtcttagacaaactgaaaaacaaatggtggtatgataaaggcgaatgtgga
agcacggactccggaagaaaggataagaccagtgctctgagcctcagcaatgtcgccggc
gtcttctacatcctgattggtggtctgggcttggcgatgctggtcgccctggtggagttc
tgctacaagtccaggactgagtctcgtaggatgaagcaatccatcagtgacgccatgcgc
tgctccacgctgacgcggatgagcgggaacgccagcggcggcgagaatggccgcgtcgtc
acccacgacttccccaaagccgtgcagacgctgccgtgcgtgggtcaccctgctggcatg
ggtctagccgcgtcaggcatgtga

DBGET integrated database retrieval system