KEGG   Electrophorus electricus (electric eel): 113587009Help
Entry
113587009         CDS       T05787                                 

Definition
(RefSeq) long-chain-fatty-acid--CoA ligase 3-like
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee00061  Fatty acid biosynthesis
eee00071  Fatty acid degradation
eee01100  Metabolic pathways
eee01212  Fatty acid metabolism
eee03320  PPAR signaling pathway
eee04146  Peroxisome
eee04216  Ferroptosis
eee04920  Adipocytokine signaling pathway
Module
eee_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:eee00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    113587009
   00071 Fatty acid degradation
    113587009
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    113587009
  09143 Cell growth and death
   04216 Ferroptosis
    113587009
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    113587009
   03320 PPAR signaling pathway
    113587009
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:eee01004]
    113587009
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eee04147]
    113587009
Enzymes [BR:eee01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     113587009
Lipid biosynthesis proteins [BR:eee01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   113587009
Exosome [BR:eee04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   113587009
  Exosomal proteins of breast cancer cells
   113587009
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 113587009
NCBI-ProteinID: XP_026881278
Position
Unknown
AA seq 713 aa AA seqDB search
MRLEEDVNHVVLLLFRVVAWLYSLLSCLPLLLLGSTRYTTSTHCSRRVKAHSASGHPAGP
YRDLDALDGLIMCLEPDVNTLDRMFEVSARRFARQDFLGTRDVLSEWEEVQENGKVFKKV
VLGEYQWLSFEQAYRAARVFGSGLAALGQEPCTNIAIFCETRAEWLIAAQACFMYNFPLV
TFYSTLGGAAIVHGLNQAEVSHIITSKELLETKLKAILMGVPKLQHIIVVEDKPTSWPGY
PRGIHIHNMAAVQKLGEKPDNAERQRRSPAADDVAVIMYTSGSTGIPKGVMISHSNLIAG
ITGTAQRVPDLNKSDTYIAYLPLAHVLELIAEMVCLAHGCKIGYSSPYTLADQSTMIKKG
SKGDSSVLQPTLMAAVPEIMDRIYKNVMQKVQEMGVVQRTLFILAYNYKMEQLSKGYSTP
LCDKLVFQKVQALLGGRTRVLLSGGAPLSAVTQRFMNICLCCPVGQGYGLTETCGAGTIS
HLWDYSTGRVGAPLVCCEIQLKDWVEGGYRSTDKPCPRGEILIGGPNVTLGYYKNETVNQ
KDFFVDENGQRWFCTGDIGEFHADGCLKIIDRKKDLVKLQAGEYVSLGKVEAVLKNCPLI
DNICAYANSEESYVIGFVVPNQQRLTVLANELGIHGTWVELCNNPVMEEEVLKTITDTAL
TGQLERFEIPQKICLSAEPWTPETGLVTDAFKLKRKEIKTYYQHDIERMYGGK
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atgaggctggaggaggatgtgaaccacgtggtgcttctactcttcagggtggtggcgtgg
ctctactccctgctctcctgcctgcccctgctcctgctaggatccacccgctacaccacc
tccacccactgctcccggcgggtgaaggcccactcagcgagtggccaccccgccgggccc
taccgggacctggacgcactggatgggctgatcatgtgtctggaaccagacgtcaacacc
ctcgaccgcatgtttgaggtctcggcgaggcgcttcgcgaggcaggacttcctcgggacc
cgagatgtgctgagtgaatgggaggaggtgcaggagaatgggaaagtgtttaagaaggtg
gtactgggggagtatcagtggctgtcgtttgagcaggcatacagagcagcgagagtcttt
gggagtgggttggctgctctagggcaggagccctgcacaaatatcgccatcttctgtgaa
accagagcagagtggctcattgctgcccaggcctgctttatgtacaactttccattggtc
actttctactctactttgggtggtgcagcaattgttcatggtcttaatcaggctgaggtt
tcccacatcatcaccagcaaagagttgctggagaccaaactcaaggcgatactcatgggc
gtgccgaagctgcagcatatcatcgtggtggaggacaagcccacctcctggccaggatac
ccgcgaggcatccacattcacaacatggctgctgtgcagaaactcggagagaagcctgac
aatgcggagaggcagaggcgatcaccggctgctgatgacgtagctgtaatcatgtacacc
agtggctccacaggcattcccaagggagtcatgatctcccatagcaacctcatcgctggg
attacagggacggcgcagagagtccctgacctcaataagagcgacacctacatcgcttac
ctgcccctggcgcatgttctagagctcatcgcagagatggtgtgtctggcccacggctgt
aagatcggctactcctcaccctacacacttgcagaccagtccacaatgatcaagaaggga
agtaagggagacagcagcgttttgcagcccactctaatggcggccgtaccggagatcatg
gatcggatctataagaatgtgatgcagaaagtgcaggagatgggggtggtgcagaggact
ctttttattttggcctacaactataagatggagcagctgtctaaaggctatagcactccc
ctctgtgacaagctggtgttccagaaggtgcaggcgttgctgggtggccgtacacgggtc
ttgttgtcaggtggtgcgcccctctctgcagtgactcagcgttttatgaacatctgttta
tgctgccctgtgggtcagggctatggcctcactgagacatgcggagctggcaccatcagc
catctttgggactatagtacaggcagggtgggagcacctctggtctgctgcgagatccag
ctgaaggactgggtggagggaggctaccggagcacggataagccctgtccacgaggagaa
attctgattggtgggcccaatgtcaccttgggttactataagaacgagacggtgaaccag
aaggacttctttgtggatgagaatggccaacgatggttctgtactggggatattggcgaa
ttccatgcagatggctgcctaaagatcattgatcgtaagaaggacctggtgaagctgcag
gcgggggagtatgtgtctctggggaaggtagaggcagtgctgaaaaactgcccccttatc
gacaacatatgtgcctacgccaacagtgaggagtcgtatgtgattggctttgtggtaccc
aatcagcagcggttgacagtgctggcaaatgagctgggaatccatggcacatgggtggag
ctctgcaataatcctgtgatggaggaggaggtgcttaagaccatcactgacacagcattg
acaggccagctggagcgttttgagatcccacaaaaaatttgtctgagcgcagagccctgg
accccagagacaggccttgtaactgatgctttcaaactcaaacgcaaagagatcaaaacc
tattaccagcatgacatcgagaggatgtatggcggcaaataa

DBGET integrated database retrieval system