KEGG   Electrophorus electricus (electric eel): 113587524Help
Entry
113587524         CDS       T05787                                 

Gene name
prodh2
Definition
(RefSeq) hydroxyproline dehydrogenase
  KO
K11394  hydroxyproline dehydrogenase [EC:1.5.5.3]
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee00330  Arginine and proline metabolism
eee01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eee00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    113587524 (prodh2)
Enzymes [BR:eee01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.3  hydroxyproline dehydrogenase
     113587524 (prodh2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_dh
Motif
Other DBs
NCBI-GeneID: 113587524
NCBI-ProteinID: XP_026882010
Position
Unknown
AA seq 475 aa AA seqDB search
MASVLMPHTLRCFLSLRVMGAPPRKLTSERSGFAPIRSQNFRFPVPSAPLTFEDPQAFRE
KSLWELVRALGVFRLCSFPLLVNHFGKIMSFARTVLGKRGFSMVLRPFVYAQFVAGETEP
EIDKSLRKMSSLGLRPMLAVPIEEDLGESTGEQRYDDNLASMLECVRMSHSNSWSKDPMM
QLKITALVSPELCVKLTSLMKEQKYDLNFFVKAMDKEVVVTFPGLSESENAHFLRGLCRL
NQIGQASINKVRVLVDAEYTYMNTALSVITMAMMKKFNQEDAWIWNTYQCYLKESRDLLL
NAIRLSVDESFCLGIKLVRGAYMDKERKLAGKEGRDDPIHQSWAQTNESYNGSLEIMLNL
ISQNPDRYKIIVATHNEESVRRTITQMDELQISRDGGLVCFGQLLGMCDHVSLTLAQQGF
SVYKSVPYGSVDDTLPYLARRAQENRAVLQGIRKERDLLRRELWRRLQGKFSGSK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggcttcggttctaatgccacacactttacgctgcttcctgtctttgcgtgtgatgggt
gcaccccctcgaaaattgacatcagagcgttcaggatttgcccccatcaggagtcaaaac
ttcagattcccagttccatctgccccactgacctttgaggatccacaggcattccgggag
aagagcttatgggagcttgtacgagcgctcggagttttcaggctatgctcttttcctttg
ctggtcaaccactttggcaagatcatgtcttttgcacggaccgtccttggaaagaggggt
ttcagcatggtccttcgtccatttgtgtatgctcagtttgtagcaggggaaacggagcct
gagattgacaagtccttgaggaagatgagctcactgggacttaggcctatgttggctgtg
cccattgaggaggacctaggagagagcactggagagcaaaggtacgatgacaacttggcg
tccatgttggaatgtgtacgcatgtcccacagcaattcttggagcaaagatcccatgatg
cagctgaagatcacagcactggtcagcccagagctttgtgttaagctgacatctttgatg
aaggaacaaaagtatgatcttaacttctttgttaaagctatggataaagaggtagtggtt
acatttcctggcctcagcgagagtgaaaacgcacattttctgcgtggcctgtgcagacta
aatcaaataggacaggccagtattaacaaagtcagagttctagttgatgctgagtataca
tacatgaacactgccctctcagtcatcaccatggcgatgatgaaaaagttcaatcaagag
gacgcctggatctggaacacttatcaatgctacctaaaagagtcaagagaccttttgctc
aacgccatccgcctgtctgtggatgaatctttctgtcttggaattaaacttgtacgaggt
gcctacatggacaaggagaggaagttggctggcaaagaaggcagagatgaccccattcac
caaagctgggcgcaaacaaatgaaagctacaacggctctctggaaattatgctgaacctc
atttcccagaatccagaccgctacaagatcattgttgcaactcacaatgaagagtccgtt
aggaggactataacacagatggatgagttacagatcagtcgagatgggggtttggtgtgt
tttggccagttgttggggatgtgtgaccatgtgtctctcactctggcccagcagggtttc
tcagtgtacaaatctgtgccatacggttcagtggacgacacactgccatacctggcacgt
cgagcgcaggagaaccgcgctgtactgcagggcatccgcaaggagagagatctgttacgg
cgagagctatggcgcagacttcaggggaagttcagtggctctaaatag

DBGET integrated database retrieval system