KEGG   Electrophorus electricus (electric eel): 113587535Help
Entry
113587535         CDS       T05787                                 

Definition
(RefSeq) guanylate cyclase 2G-like
  KO
K22600  guanylate cyclase 2G [EC:4.6.1.2]
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee00230  Purine metabolism
eee01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eee00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    113587535
Enzymes [BR:eee01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     113587535
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc ANF_receptor Pkinase_Tyr Pkinase HNOBA Peripla_BP_6 DarA_N
Motif
Other DBs
NCBI-GeneID: 113587535
NCBI-ProteinID: XP_026882026
Position
Unknown
AA seq 1136 aa AA seqDB search
MTGASDSGEAKHSRWWLLLYFSLSTLTTSVACSQTNQNKLLVGLQAPRNASYPFSALKLA
SALQIAIDKINSNPSFLENYTLDFVYVDTDCNAKVSLGAFIDQMWRENISALFGPPCPEE
AEVTGLIASTWNIPMFAFVGQTSKMDNALVYDTYVKVVPPLKRVGEILLKVLEFFGWKHV
GIIGGGADSNTWDKLDALWKSVEQQLQAKVTLTATIKFDPSDPHLMQKNMQHISKVARVV
VLLSSAEDSVKLILEAERQGLMNGEYVFLLIQQFEVSGNVDSLWRYAMKDNYKAALKAFE
MVFVIAEKAYDGYDYYDFYERVYERLKGPPFHSNLTSEKEVSPYSSYLHDAVLLYAMGLK
EVLKEGRDLHNGRELLQKLRDKNSIKFNGASGLVHFDEYGDRNTDYSVYDLQKSEDIVKF
VPILNFDSHTKLIKTTPKFSSVIWPTGKLPTDNPKCGFDNERCEWLNNEIYLVVLLVTMP
LLGVAALVFITLLTLQKVRLQTRLDDSYWWLINYSDITIISEPKGVQALSINTTPSKSGS
GGSQTILSNNSYALKDKNERENIYTTVGLYQGNHVGIKYPENQLLRDLNKPSILAEFTMM
KELKHENLVQFFGVCNEPPNVCIVMQYCKKGSLKDVLRNSEVELDWMFKLAFAYDIVNGM
EYIHRSSLKSHGNLKPTTCLVDSRLQVKLSGFGLWEFKHGIKHKLIALDNPKYEEMYWTA
PELLREVHLPLNGSQKGDVFSFAIIMRELIYSTEVGPYHDIQLEPKEIIRQLRTPLAGEP
LRPTLSAQTCDDGLIALLNACWSENPDQRPPFTSIRRGLRDISPESHANILDNMVNKLEK
YANHLEEVVEERTNQLTVEKSRADKLLSSMLPRYIAEQLMAGKCVEPRSYDIVTIFFSDI
VGFTTMCSVSSALEVVTLLNDLYSLFDEIIKLYDVYKVETIGDAYMVASGLPLSNGSRHA
EDIATMAIHFLSAIKRFRIRHMPSERLALRIGINSGPVVAGVVGTTMPRYCLFGDTVNTA
SRMESSSLPLRIHISQSTADILLKIGSFEMEERGDIELKGKGVQKTFWLYNRVGVKFLPI
KQHYEEGTNSELAGQEVNTPNTSNEPESKKSGRTQKDPPWIKHKSFTHWQSLTSRD
NT seq 3411 nt NT seq  +upstreamnt  +downstreamnt
atgacaggagcatcagactccggagaagccaagcatagcagatggtggctgctcctatat
ttttcactttctacactcaccacctctgtggcttgtagccaaacaaaccaaaacaagctg
ctggtagggttacaggccccccgaaatgcctcctatccattcagtgctctgaagctggcc
tctgccctccagatcgcaatcgacaaaatcaactccaatccatctttcctcgaaaattat
actcttgactttgtgtacgtggacactgactgcaatgcaaaagtttcgctcggagcgttc
atcgaccaaatgtggcgagagaatatatcggcgctctttggtccaccgtgtcccgaagag
gcagaggtcactggtctcattgcctctacctggaacatcccaatgtttgcctttgttgga
cagacatccaaaatggataatgctcttgtttacgatacctacgtcaaagtagtgcctcca
cttaagagagtaggagaaattttgcttaaggtattggagttctttgggtggaagcatgtt
ggtataattgggggaggtgccgattctaacacatgggacaaattggatgctctctggaaa
tctgtggaacagcaactccaagccaaggtcactctgacggccaccatcaagtttgatccc
agcgaccctcatctcatgcagaagaacatgcaacacatctccaaagttgcaagagtggtt
gtgctgttgagtagtgccgaggactccgttaagctgattctggaggccgagagacaaggt
ctgatgaatggagagtatgttttccttctcatacaacagtttgaggtcagtggcaatgtg
gatagcctatggagatatgccatgaaagacaactacaaagctgcactaaaggcttttgaa
atggtgtttgtcattgctgagaaggcttatgatggctatgactactacgacttttatgaa
cgtgtctacgagaggttgaaagggcccccttttcatagcaaccttacatcagaaaaggag
gtaagcccatactctagttatctgcatgatgcagtcctgctctacgccatgggtctgaag
gaggttctcaaagaaggcagggatctccataatggacgagaacttctccagaagctcaga
gacaaaaacagcatcaagttcaacggggcctccggtttagttcatttcgatgaatatgga
gacaggaacacagactactctgtatatgacttgcaaaaaagtgaagacattgtgaaattt
gtccccattttaaattttgacagtcataccaaattgatcaaaacaacaccaaagttttca
agtgtgatttggccaacagggaaattgccaacagataacccaaagtgtggttttgacaat
gaacgctgtgaatggctaaacaatgaaatctatctggttgtcttgctggtgaccatgcca
ctgctgggagtggctgcactggtcttcatcacactcctcaccctgcagaaggtccggctg
cagaccagactagacgactcatactggtggctcatcaactacagtgatatcaccatcatc
tcagagcccaagggagtgcaggcattgtcaataaatacaactccgagtaaaagtggaagt
ggaggctctcaaacaattttgtcaaataacagctatgctctaaaggacaaaaacgaaaga
gagaatatctacacaacagttggtctgtaccagggaaatcatgtaggtatcaaatacccg
gagaatcaacttctgcgtgacctcaataaaccgtccatccttgctgagttcactatgatg
aaggagctgaaacacgagaaccttgtgcagtttttcggggtgtgtaacgaacccccaaat
gtctgcattgtcatgcagtactgcaagaaagggagcttaaaggatgttctcaggaacagt
gaagttgagttagactggatgtttaaactggcctttgcttatgacattgtcaatggtatg
gagtacatacacagaagcagtctgaagtctcacggtaatctgaagccaaccacctgccta
gtggacagccggctgcaggtcaaactctcgggatttggcctctgggagttcaaacatggc
atcaaacacaaactgattgcacttgataatcccaaatatgaagagatgtactggacggct
ccagagcttttgagggaggtgcacctgcccctcaacggttctcaaaaaggcgacgtattc
agctttgccatcatcatgcgggagctgatctacagcacagaggtgggcccctaccatgac
atacagctggagcccaaagaaatcatcaggcagctgaggactcctctagcaggtgagccc
ctgagacctactctgtctgctcagacgtgtgatgatggactgatcgcccttctgaacgcg
tgctggagtgagaaccctgaccagaggccccccttcacatccatccggagaggcctacga
gacatcagcccagagagccatgcaaacatcttagacaacatggtaaacaagcttgagaaa
tacgccaatcacctggaggaagtagtggaggagaggaccaatcagctcactgtagaaaag
agcagagctgataagcttctctccagcatgctgcccagatacatagcagagcagctaatg
gcggggaagtgtgtggagccccggagttacgacattgtgaccatcttcttctcggacatt
gtgggcttcaccaccatgtgttcagtcagctcagccctggaggttgtcacactgctcaac
gacctctacagcctgtttgatgagatcatcaaactctatgatgtatataaggtggaaact
ataggagacgcatatatggtggcaagtgggttgcctctaagcaatggcagcaggcatgca
gaggacatcgcaaccatggccatccacttcctaagcgctattaaaaggttccgaatcaga
cacatgcccagcgagaggctggctctgaggattggaatcaactctggtccagtggtggct
ggtgtggtggggactaccatgccccggtactgtttgtttggggatacagtgaacaccgca
tccaggatggagagcagtagtttgccactgaggattcacatctctcagagcactgctgac
attctcctgaagattggttcttttgaaatggaggaaaggggagacattgagctgaaggga
aaaggggtgcagaagactttctggttgtacaatagagtaggtgtgaagtttcttcccatc
aagcagcactatgaagaaggaacaaattcagaactcgcaggacaggaggtaaatacacca
aatacctcaaatgagccagaaagcaaaaagagtggaaggacccagaaggacccaccatgg
ataaaacacaagagcttcacacactggcagtccctgacatctagagactaa

DBGET integrated database retrieval system