KEGG   Electrophorus electricus (electric eel): 113587593
Entry
113587593         CDS       T05787                                 

Definition
(RefSeq) ankyrin repeat domain-containing protein 53-like isoform X1
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
eee  Electrophorus electricus (electric eel)
Brite
KEGG Orthology (KO) [BR:eee00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:eee03036]
    113587593
Chromosome and associated proteins [BR:eee03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    113587593
SSDB
Motif
Pfam: Ank_5 Ank_2 Ank_4 Ank Ank_3
Other DBs
NCBI-GeneID: 113587593
NCBI-ProteinID: XP_026882120
Position
Unknown
AA seq 423 aa
MPNVARYPSCRAKLKMSLTSLPRSRNASGVVRWVHKPPPASDMFQAAVSGDQEWLSLSLK
RALSATQRNKQGLTVLHVAAQYGRLDCVKLLVESRYVDVNAGCPRGRRPIHMVLSPQSRP
HSYACLTYLLEQGAEPDVSTDEGVTPLHMAAAEGLRKCVETLVKVGANTHVCDSRGHTPF
DLARLWGHRVIARFLKNAMWQRDKKEEMERCRALQDLRQTLTALHRKAKFQEKVFREALI
GDKLSKWAEKKGLPLLWTPLRDSWTLHHAQCLSSEPTKSKSAKTKKHHSGSPREAWNVSP
NPSRPPPASISRPQQVRMGVHPEKAAVEPDLHQSVRLHRSTDGRVHYTMLWNGVSHPTPT
LPLDVVQRGLFPLVFPSRIASPLHFQCSSVLDLPRRGRTPQAGASPWTEVAMHLAEELEP
GKY
NT seq 1272 nt   +upstreamnt  +downstreamnt
atgccaaatgtagctaggtatcctagctgtcgtgctaagctaaagatgtctcttactagt
ttgcctcgcagccgtaatgcttctggggtggtacgatgggtgcacaaaccaccccccgct
agcgatatgtttcaagccgcagtttcgggggaccaagaatggctcagtttgagtctgaag
agagcgctgtcggcgacgcagcggaacaaacagggtctcaccgtgctacacgtggccgcg
cagtacggcaggctggactgcgtgaagctgctcgtggagtctcgttacgtggacgtgaac
gctggctgcccgcgtgggcggagacccatacacatggtgctcagtccccagagcagacct
cattcctacgcctgccttacatacctgctggaacagggagccgagcccgacgtctccaca
gatgaaggagtaacacctctgcatatggctgctgctgaaggtctgagaaagtgtgttgaa
accttggttaaagtcggagccaacacacatgtgtgtgatagcagggggcacacacccttt
gaccttgctcgtctctgggggcatagggtaattgcgaggtttctgaaaaatgccatgtgg
cagagagataagaaggaggagatggagagatgcagagcactgcaggacctcagacagact
ctgactgccttgcacaggaaagcaaagtttcaggaaaaggttttcagagaggcccttatt
ggggacaagttgtccaaatgggctgagaagaagggcctgcccttactctggacccctttg
agggactcctggacattacaccatgcccagtgcctgtcttctgaacctaccaaatcaaag
agtgccaaaacaaagaaacaccactcaggttcaccaagagaagcatggaatgtctccccc
aacccgtccagacctcctcctgctagcatcagcaggccgcagcaggtgcgaatgggtgtc
catccagaaaaggcagcagtcgagccagatctgcatcagagtgtcaggctgcatcggtcc
acggatggccgtgtccactacactatgctgtggaatggtgtttcacatccaacgcccacc
ctgccgctagatgtcgtccagaggggcctgtttccattagtgttcccctcacgaattgct
tctccactgcacttccagtgtagcagtgtgctagacctgcctcgccgagggcgcacacca
caagcgggtgcctcaccctggactgaggtggccatgcacctggctgaggagctggagcca
gggaaatactga

DBGET integrated database retrieval system