KEGG   Electrophorus electricus (electric eel): 113587810Help
Entry
113587810         CDS       T05787                                 

Gene name
dock7
Definition
(RefSeq) dedicator of cytokinesis protein 7
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
eee  Electrophorus electricus (electric eel)
Brite
KEGG Orthology (KO) [BR:eee00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:eee04131]
    113587810 (dock7)
Membrane trafficking [BR:eee04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    113587810 (dock7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N
Motif
Other DBs
NCBI-GeneID: 113587810
NCBI-ProteinID: XP_026882485
Position
Unknown
AA seq 2099 aa AA seqDB search
MAERRAFAQKISRTVAAEVRKQIAGQYGGSPQLLKHLSVGGNAASNSVPLTEAVEPVDFE
EYLITHPPIIESGPLRDLIEFPPDDIEVLYMPRECRTLGQAVTEEGDNDAHVRDCIRSYT
EDWAVVNRKYHKLGTGFNPNTLDRQKERQRGLPKQVFESDELPDSSSYQDDQDELKRRSM
SIDDTPRGSWACSIFDLKNSQPDALLPHLLDRAPNEEIDRHNEEHRKASRHREVFALHPA
LEEEEPIERHCVPDVPKEHFGQRLLVKCLSLKFEIEIEPIFASLALYDVKEKKKISENFF
FDLNSEQTKAMLRPHTQSAAISTLARSAIFSITYPSQDVFLVIRLEKVLQQGDIGECAEP
YMVFKESDAAKNKEKLEKLRAQSEQFCQRLGRYRMPFAWTAIHLMNIVNSAGSLERDTDL
ELGLPERKGSWSERRNSSIVGRRSLERTTSGDEYCNLTSFRPATLTVTNFFKQEGDRLSD
EDLYKFLADMRRPSSVLRRLRPITAQLKIDISPAPENPHYCLTPELLQVKPYPDSRVRPT
REILEFPAKDIYVPNTTYRNLLYVNPQSLNFANRQGSARNITVKVQFMNGEDPSNAMPVI
FGKSSCAEFSKEAYTSVVYHNRSPDFHDEIKIKLPPSLTDHHHLLLTFYHISCQQKQNTP
LETPVGYTWIPMLQNGRLRTGHFCLPVSLEKPPQSYSVLSPDVPLPGMKWVDNHRGVFNV
EVVAVSTIHTQDQYLDKFFALVHALDEHMFPVRIGDMRIMENNLEAELKGSIAALSSSQL
EPVVRFLHLLLDKLVLLAVRPPVIAGQIVNLGQASFEAMASIVNRLHKYLDTSQDMHGRN
SLLSSYIYYIFRLPNMDPNSPSPGPGGLGGSVHYATMARSAVRPASLNLNRSRSLSNSNP
DISGTPTSPDDEVRSIIGNKGLDRSNSWVHTMGCKSGPWGSSPGSASDTVQVIYKSSPFK
KNKNTTKNAFQVKSIIHHLYFTDRLESPRKNRFPERFMDDITALVSTIAGDIVSRFQKDL
ELVERLNTSLAFFLNDLLSVMDRGFVFTLIKAYWKQVSTKLYALQNPTLESLRLDFLRIV
CSHEHYVTLNLPCSLLTPPASPSPSVSSATSQSSGFSTHVQDQKIANMFELSVPFREQHY
LAGMVLTELAVILDPEADGMFGLHKKVISVVHNLLSSHDSDPRYADPEVKARVAMLYLPL
IGIVMETLPQLHDFTESHNQWGRPGGSATDEQETEGNSMISQTVAMAIAGTSVPQMSRPS
SFLLNPQATRQHGTFSPESSRSLLICLLWVLKNADELVLQKWFTDLSVSQLNRLLDMLYL
CVSCFEYKTHFLFMQGKKAFERMNSLTFKKSKDMKAKLEEAILGSIGARQEMVRRSRGQL
ERSPSGSAFGSQENLRWRKDMTHWRQNSEKMDKGHRSVRTRAELEHEALIDGNLATEANL
VILDTLEIIVQTVSVTESKESILGGVLKVLLHSMACNQSALYLQHCFATQRALVSKFPEL
LFEEETEQCADLCLRLLRNCSSCISTIRSHASASLYLLMRQNFEIGNNFARVKMQVTMSL
SSLVGTSQNFNEEFLRRSLKTILTYAEEDLELRETTFPDQVQDLVFNLHMILSDTVKMKE
HQEDPEMLIDLMYRIAKGYQTSPDLRLTWLQNMAGKHSERNNHAEAAQCLVHSAALVAEY
LSMLEDRKYLPVGCVTFQNISSNVLEESAVSDDVVSPDEEGICSGKYFTEAGLVGLLEQA
AASFSMAGMYEAVNEVYKVLIPIHEANRDAKKLATIHGKLQEAFGKIVHQSTGWERMFGT
YFRVGFYGSKFGDLDEQEFVYKEPAITKLAEISHRLEGFYGERFGEDQVEVIKDSNPVDK
CKLDPNKAFIQITYVEPYFDTYEMKDRITYFDKNYNLRRFVYCTPFTLDGRAHGDLHEQY
KRKTILTTSHAFPYIKTRINIIHKEEIISMPIEVAIEDMQKKTQELAFATHQDPADAKML
QMVLQGSVGTTVNQGPLEVAQVFLSEIPSDPKLYRHHNKLRLCFKDFTKRCEDALRKNKS
LIGPDQKEYQRELERNYHRLKEALQPLINRKIPQLYKPVLQVNSHRDSFSRMSLRKFEM
NT seq 6300 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcgccgcgccttcgcccaaaaaataagcaggaccgtagctgctgaggtgaga
aagcagattgctggtcagtatggagggtctcctcagctcctcaaacacctcagcgtgggt
gggaatgcagcaagcaattcagtccctttgactgaggccgtggagccagtggactttgag
gagtatttgattactcacccgcccatcatagagtcaggacctctgagagatctgattgag
ttccctccagatgacattgaagttctttacatgcccagggagtgtcgcactttgggccag
gcagttacagaggaaggggacaatgatgctcatgtccgagattgtatcaggtcctacact
gaggactgggctgtggtcaaccgcaagtaccacaagctaggtacaggcttcaaccccaac
accctggacaggcaaaaggagaggcagagaggtttacccaagcaggtctttgagtcagac
gagctgccagattccagcagctatcaggatgatcaggatgagctgaagcgcaggtccatg
tccatcgatgacactccgcggggtagctgggcatgcagcatatttgacctgaagaactcg
cagcctgatgccctgctgcctcacctgctcgaccgagcacccaacgaggagatcgaccga
cacaatgaggagcatcgcaaagccagccgacaccgcgaggtcttcgctctgcaccctgct
ctggaggaggaagaaccaatcgagcggcactgtgtgcctgatgtcccaaaggaacacttt
ggacagcggctactcgtcaaatgcttgtccctgaagtttgagattgaaattgagccaata
ttcgcaagtttggccttatacgatgtcaaggaaaagaaaaagatatcggagaacttcttc
tttgacctgaactccgagcaaaccaaggctatgttgcgccctcacacccagtccgccgct
atctctacactagctcgctctgccatcttctccatcacttacccttcccaagacgtcttt
ctggtcatcaggcttgaaaaggtgctacagcagggggatattggagaatgcgcagagccc
tacatggtcttcaaagagtcagatgctgctaaaaataaggagaagctggagaagcttcgt
gctcagtcggagcagttctgccagcgtctcggccgctaccgcatgccctttgcctggacc
gccatccacctgatgaacattgtgaacagtgcaggcagcctggagagagacacagacttg
gagctaggtctgcccgaacggaagggttcgtggtcagagcggagaaactcgagcattgtg
ggtcgtcgctccttggaaaggaccaccagtggagacgagtactgcaatcttaccagtttc
aggcctgcaactctcacagtcactaatttcttcaagcaggagggagatcggctaagtgat
gaagatttgtacaagttcttagctgacatgagacgcccttcctctgtgttacgaagactt
agacctatcacggctcaactgaagattgacatatctcctgcacctgagaacccccactac
tgtctgaccccagagctcctccaggttaaaccttacccagacagtcgagtgcggccaacc
agggagattctggagttcccagccaaggacatctatgtgcccaataccacgtacaggaac
ctgctctatgtgaacccgcagagcctgaactttgccaaccgccaaggctctgcccgcaac
atcactgtgaaagtgcagtttatgaacggggaggaccccagcaatgccatgcctgtgatc
tttggcaaatccagctgtgcagagttttcaaaagaggcatacacgtctgtggtctatcac
aaccgatccccagattttcatgatgagatcaagattaagcttccaccttctctgacggac
catcaccacctcctcttaaccttctaccacatcagctgccagcaaaagcaaaacactcct
ctggagacgccggtcggctacacgtggatcccgatgttgcagaatggccgtctaagaaca
ggccacttctgcttaccggtgtctctggaaaaaccacctcagtcttactccgttctctct
ccagacgttcctcttcctggtatgaagtgggtggataaccacagaggagtgttcaacgtg
gaagttgtcgccgtgtccaccatccacactcaggaccagtatctggacaagttctttgcg
ctggtgcatgctctggatgagcacatgttcccggtgaggatcggagacatgcgcatcatg
gagaacaacctggaggcggagctgaagggcagcattgcggcgctgagctcctcccagctg
gagcctgtggtgcgcttcctccacctgctcctggacaagttggtcctgctggcagtgcgg
ccacctgtgatcgcggggcagattgtaaaccttggtcaggcctcctttgaggcgatggcg
tccatagtgaaccgtttgcataagtatctggacaccagtcaagacatgcatggccgcaac
agcctcctctcctcgtacatctactacatcttccgtctaccaaacatggatcccaactct
ccttccccgggccccggaggcttggggggttcggtgcattatgccaccatggcccgatct
gctgtcagacctgccagcctcaacctcaaccgctctcgtagccttagcaacagtaaccct
gatatctcgggcacgcctacgtctccggacgacgaagtacgctccatcatcggcaataag
ggcttagatcgctccaactcctgggtgcacaccatgggttgcaagagtggcccctggggg
tccagccctggctcagcatctgatactgtgcaggtcatttataaatcctccccttttaaa
aaaaataaaaacacaaccaaaaatgcatttcaggtaaaaagcataatccaccatttgtac
ttcactgaccgtctggagtcccccaggaagaaccgcttccctgagcgcttcatggatgac
atcactgctcttgttagtaccattgcaggcgatatcgtctcccgcttccagaaggatctg
gagctggtggagcggctcaacacgagtttggccttcttccttaatgacttgctgtctgtc
atggacaggggctttgtcttcaccctcatcaaagcgtactggaaacaggtgtccaccaag
ttgtacgccttgcagaaccccacgctggagtccctgagactggacttcctgaggatcgtg
tgtagccatgaacactatgttaccctgaacctgccctgcagcctgctcacgcccccggcc
tctccatccccctcggtgtcttctgccacctcgcagagctctggtttctccacccatgtg
caggaccagaagattgctaacatgtttgagctatcagtaccctttagagaacagcattac
cttgctggtatggttctgactgagctcgccgtgatcctggacccagaagctgatgggatg
tttggcctacataaaaaggtgatcagtgttgtccacaacctgctgtccagtcatgattct
gacccccgatatgccgaccctgaagtcaaagccagggtggccatgctctacctgccactc
ataggcatcgtcatggaaaccctgccccagctccatgacttcacggaatcccataaccag
tggggccgccctggtggctcagcgacagatgagcaggaaacggagggcaacagcatgatc
agtcagaccgtagccatggcaatagcaggcacttcagtaccacagatgtcacggccgagc
agtttcctgttgaacccacaggccacccgtcagcatggaactttctctcctgagtccagt
cgcagtttgctcatctgtctgctgtgggtgttgaagaacgcagatgaactggtgctgcag
aagtggttcactgacctctctgtgtcccagctgaaccgtctgctggacatgctctacctc
tgtgtatcctgctttgagtacaagacccattttttgttcatgcaggggaaaaaggcattt
gagcgcatgaacagtctaacctttaagaagtctaaagacatgaaagccaagctggaggag
gccattctgggcagcatcggagcaaggcaggagatggtacgacgcagccgaggacaactt
gagcgcagcccctcaggaagcgcctttggcagccaggagaacctgcgctggaggaaagac
atgactcactggcgtcagaacagtgaaaagatggacaagggccacagatctgtcagaacc
agggctgagctcgagcatgaggcacttatagatggcaatctggcaaccgaggccaacctc
gtcatcttggacactctggaaatcatagtgcagaccgtgtctgtgaccgagtcaaaggag
agcattctgggaggagtcctcaaagtcctgcttcatagtatggcgtgcaaccagagcgcc
ctctatctgcagcactgctttgcaacgcagagagctctcgtctcaaagttccctgagctg
ctgttcgaagaggagacggagcagtgtgctgacctgtgcctccgtctgctccgcaactgt
agcagctgcatcagcaccatccgctctcatgccagtgcctccctctacctgctcatgcgg
cagaactttgagatcgggaacaattttgcccgagtgaaaatgcaggtgactatgtccctg
tcgtctttggtgggcacatcccagaacttcaacgaggagttcctgcgacgttcactcaaa
accatcctgacctacgctgaggaggacctagagctccgagagaccacctttcctgaccag
gtgcaagacctggtttttaacctacatatgattttatcagacacagtaaaaatgaaggaa
catcaagaggatccagagatgcttattgacttaatgtatagaattgctaagggctatcag
acgtctcctgacctgcgtctgacgtggctgcagaacatggcagggaagcactctgaaagg
aataaccacgcagaggcggcccagtgcctggtccatagcgccgccctggtggcagagtac
ctcagtatgctggaggaccgcaaatacctgcctgtgggctgtgtcacgttccagaacatt
tcttccaacgtgctggaggagtctgccgtgtctgatgacgtggtctcgccagatgaggag
ggcatctgctcagggaagtacttcaccgaggctggcctggtggggctgcttgaacaagct
gcagcttctttctccatggctggcatgtatgaagcggtgaacgaagtctacaaagtgctc
atccccattcacgaagccaacagggacgctaagaagctggccaccattcatggtaaactg
caagaagcctttggcaaaatcgtgcaccagagcactggctgggagcggatgtttggtact
tacttcagagttgggttttatggttctaaatttggtgacctggatgagcaagagtttgtg
tacaaagagccagccatcaccaagctggctgaaatctcgcatcggcttgagggtttctat
ggtgagagatttggggaagatcaagttgaagtcataaaggattccaatccagtggacaaa
tgtaaactggatccaaataaggctttcattcaaatcacttacgtggaaccctactttgac
acgtacgagatgaaagatcgcatcacgtactttgacaagaactacaacctgcggcgcttt
gtttactgcacgccattcacgctggacggccgggcacacggtgacctgcacgagcaatac
aagcgcaagaccatcctcaccaccagccatgccttcccatacatcaagacccgcattaac
atcatacacaaggaggagatcatctccatgcccattgaggtggccattgaggacatgcaa
aagaaaacccaggagctggcctttgctacgcaccaggacccggcagacgccaagatgctc
cagatggtgctgcagggctctgtgggcaccactgtcaaccagggtccacttgaggttgcc
caggtgttcctgtctgagattccaagtgatcctaaactctataggcaccataataaactg
aggctttgctttaaagactttaccaagagatgtgaagatgcccttcgcaaaaataagagt
ttgataggtcccgatcaaaaggagtaccagagggagctggagcggaattaccacaggttg
aaggaagctcttcagcctcttattaaccggaagattccccaactctacaaacctgtgctc
caggtcaactctcatagggactccttcagcagaatgagccttcggaaatttgaaatgtga

DBGET integrated database retrieval system