KEGG   Electrophorus electricus (electric eel): 113588656
Entry
113588656         CDS       T05787                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: AF4/FMR2 family member 3-like
  KO
K15195  AF4/FMR2 family member 3
Organism
eee  Electrophorus electricus (electric eel)
Brite
KEGG Orthology (KO) [BR:eee00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:eee03021]
    113588656
Transcription machinery [BR:eee03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     113588656
SSDB
Motif
Pfam: AF-4_C AF-4 AF4_int
Other DBs
NCBI-GeneID: 113588656
NCBI-ProteinID: XP_026883737
Position
Unknown
AA seq 1141 aa
MTHSWPSRQAPGGGGTERFLYSDSKQEKKRPTSQHRHVREDASVRMPRMAPQKSMLADDL
KLSSDEDEGNKGPQQTTSWTENHNLAGQRAYTHSGRVRHSTSGSSASDSSSESESSGRCS
RSPSPGEQPRSGSPCQPPTLASGRQDPSVTHWQLDKWFEKVRKNRPSVDHEPRGGPSSSA
AFQSSPGLSPGRYWERDPSLGSRQDYSPRYSPVPSPQFDYRQSPYSSPGYSTCPSPGNSP
GNSPVPSVCPSPGASPQGNRSPSPLPLHPPKSPSLAPASASPRLTSCHRGPAHRETPRPP
ARPTLASGPACRPKARPCPDHRAQRINEPRPKDSRPPAFPKHHAKHSSAHSETPHRPKGP
SRTRSSPAPNSSPRHRTGYSSGPSPKTKSGHPSSAAPSTQRSHTHADAKSKFGLNAKPKH
SSTPKPKHAAPGETSSRPAHGPDPDAADRPLSKPASRRTPSPKPKGKTREVPAPVLGPFQ
KEPKARERGQAQGGAPVRVAEAQRRGRLAEEQLVNQRRVRSSAGEDEEEERTRKKRKKGH
HVEWQAVQPKQRPHTNSQHHPRERGRPEWAEPRERKRRRSCEESSSHPGAVGSNPSPPLS
PPNPALAVTRRSSSSSSSSSSSPSSSSSESSSESDSEPGPPPNVAKVPADSTSSRXPRSP
GRARPXHAGPDDPSPAKGQQHRGKHRLYTLVPFGRTEQSSKVSHRGLRDLVVKIDLALLT
RVPSTSEVPQRRLSSSSSTSSSSKTKEKTPMRNQYHREPAEARAKRKAENGEAPRDSKRS
LLHADKASSGSHADGSENKESHGNDPQNGHGEDYFYTKRPVSPLSPPSAVKTQNSDQQQA
QRDREPTVKKTQVQRSQPKIESEFAGMSGNTQPPSGSWVPPANQPATSRGTVPCTDVSHH
VEYYMHEAKRLKHRADAMVDKLGKAVNYVDAALSFMECGKAMEESPLEAKSPYAMYAETV
DLIRYAMRLKSHTGPAARQEDKQLAVLCFRCLALLYWQMFRLKKEHALKYSKALLDYFKS
SPKVPHTQASWNDSTKGNVLPSCASPVGLTGPPSGCCSASPFISIPQRIHQMAANHLNIT
NSVLYSYEYWEVADTLAKENKEFFNYLNTLTGPLTLHSSMAHIVQYTRQGLQWIRISAHL
S
NT seq 3426 nt   +upstreamnt  +downstreamnt
atgacccactcctggccttcccggcaggctccggggggagggggaactgaacggttcttg
tattccgactcaaagcaggagaagaagcggcccacctctcagcacagacatgtgagggag
gacgcctctgtgaggatgcctcgcatggcacctcagaaatcaatgcttgctgatgacctg
aagctcagcagtgacgaggatgaaggcaacaaggggcctcaacaaaccacttcctggact
gaaaatcataacctggcgggacagagggcatacacacatagcgggagggtgagacattcc
acctcgggttcctcggcgtcggactcttccagtgagtcggagagcagcggccgatgttca
cgcagcccgagccccggagaacagccccggtctgggtcaccctgccagccacccaccctg
gcctccggcagacaggacccatcagtcacacactggcagctagacaagtggttcgagaaa
gttcgcaagaaccgtccgtcagtcgatcacgagcccagaggcggtccgagttccagtgcc
gccttccagtccagcccaggcctgtctcccgggagatactgggagcgtgatccgagcctg
gggtccagacaggactacagccctagatacagtcctgtgcccagccctcagtttgactac
agacagagtccttactccagtccagggtacagcacatgcccaagccccggaaacagcccc
ggaaacagccccgtgccaagtgtttgccccagccctggtgccagcccgcaggggaaccgt
agtccaagccctctgccccttcacccacccaaaagccccagcctcgcccctgcctctgcc
tctcccaggctcacctcctgtcaccggggtcccgctcaccgggaaacccccaggcctccg
gcacggcctactctcgcctccggtcccgcgtgtcggcctaaggcgaggccgtgtccggac
cacagggcgcagcgtattaatgagccaaggcccaaagattccagaccgcctgcttttccc
aagcaccacgccaagcacagctccgctcacagcgagactccacaccggcccaaaggcccg
agcagaaccagatccagtccggcgccaaattccagtccaaggcatcggacggggtacagt
tccgggccaagcccgaaaacaaaatccgggcatccgtcctccgccgcccccagcacccag
cgcagccacacacacgccgatgctaagagcaaattcggtttaaacgccaagccgaaacat
agctccacccccaaacccaagcacgccgcccccggcgagacgagcagtcgtcccgcccac
gggcctgacccagacgccgcagaccggcctctgtccaagccagcatcaagacggactccc
agcccgaagccgaagggtaagaccagagaggtccctgcgcccgtcctcgggccctttcag
aaggaaccgaaggccagagagagggggcaggcccagggtggagccccggtccgagtcgct
gaggcccagaggcgggggagactggcggaggagcagctcgtaaaccagcgccgggtccgg
agctctgcgggggaggacgaggaggaggaaaggacgaggaagaagaggaagaaggggcat
catgtggagtggcaagcggtacagcccaagcagagaccccacactaacagccagcaccac
ccccgcgagcgcggccgacctgagtgggcggagcccagagaaaggaagaggaggcggagc
tgcgaggaaagctcctcccaccccggagctgtaggttccaacccttctccgcctctctca
ccacccaacccggcgctcgcggtcactcgcagatcttcctcctcctcctcctcgtcctcg
tcctccccctcgtcctcttcctcagagtcttcctcggagtctgactccgagcctggcccg
cccccgaacgtcgccaaggtccccgcggactccacatccagccggngcccgcggagtccg
gggcgtgcgcggcccnaccacgccgggcccgacgatccgtccccagcgaaagggcagcag
catcggggaaaacacagactctacaccctggtgccgttcggccggacagagcagtctagc
aaagtctcgcacagaggcctgagggatctggttgtgaagatagacctcgctctcctgacc
agagtgcctagcacgagcgaggttccccagagaaggctctcgtcatcatcatcgacttct
tcatcgtctaaaactaaagaaaaaacacccatgagaaaccagtaccaccgtgagccagca
gaggccagggctaaacgtaaggctgaaaacggagaggctccgagagacagcaagagaagc
cttcttcacgcggacaaggcctcgtctggttctcacgccgacggcagcgagaataaggag
agccacggcaacgacccacagaacggacatggcgaggattatttttacaccaagaggccc
gtgtcccccctctcccccccgtcggccgtgaagacgcagaattccgaccagcagcaggcg
cagcgggacagggagcccaccgtgaaaaaaacgcaggtgcagagatctcaacccaagata
gagtcagagtttgctggcatgtcgggaaacacgcagcctccttctggatcctgggtccca
ccagcgaaccagccagcgacctcccgaggaaccgtgccttgcaccgacgtctcacaccac
gtggaatactacatgcacgaggccaaacgactgaaacatcgggcggacgccatggtggat
aagctggggaaagccgtcaactatgtggatgccgccctgtcctttatggaatgtggcaaa
gccatggaggagagccccctagaggccaagtctccttatgccatgtacgcagaaaccgtg
gacctcataagatatgccatgagactgaagagtcacacaggccccgcagccaggcaagag
gacaagcagctggctgtgctctgtttccgttgtctggctctcctgtactggcaaatgttc
cggctgaagaaggagcatgcgctgaaatattccaaagcactgctggactactttaagagt
tctccaaaagtgcctcacactcaagcttcctggaatgattccacaaagggaaacgtactt
ccatcttgtgcctcccctgtcggtttaacgggacctccgtctggctgctgttccgcctcc
ccgtttattagcattccccagcgcatccaccagatggcagcaaaccacctcaatatcacc
aacagcgtgctctacagctatgagtattgggaggtggccgacaccttggccaaggaaaac
aaagagttctttaactatctgaacacgttaactggacccctgactctgcacagcagtatg
gcccatatagttcagtacaccagacagggactgcagtggattcgaatcagcgcccatttg
tcttga

DBGET integrated database retrieval system