KEGG   Electrophorus electricus (electric eel): 113589083Help
Entry
113589083         CDS       T05787                                 

Gene name
pik3c2b
Definition
(RefSeq) phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta
  KO
K00923  phosphatidylinositol-4-phosphate 3-kinase [EC:2.7.1.154]
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee00562  Inositol phosphate metabolism
eee01100  Metabolic pathways
eee04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:eee00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    113589083 (pik3c2b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    113589083 (pik3c2b)
Enzymes [BR:eee01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.154  phosphatidylinositol-4-phosphate 3-kinase
     113589083 (pik3c2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_C2 PI3K_rbd PX C2 DUF4135
Motif
Other DBs
NCBI-GeneID: 113589083
NCBI-ProteinID: XP_026884352
Position
Unknown
AA seq 1579 aa AA seqDB search
MSAAQTQSDSEQRWGCLESLGLSPRELVLAEALQMEYDALSRLKQDKGPPGTVSPDTRTE
RLSPRPLPSPPGGSLHPGLSGSDPALNLTQPGVSNPSRSNLESRSYSKEPLYILDTQGKS
DNEGTSGMLMKGLPPPDEPPPAVPPRNPVPQLDSFMTRRGSAPRDVNLFTPEEDQPKMPC
GDTMNYDNLNDSLMRLNEDWPSPRRRKVNGDQLGKPVARSKTLPPQVPPRTYLAGPKSTK
STRRVSADPVSLGSKLNGFGYELFQVSEERDEEVAAFCHMLDVLRSAYPCTERSKNAGFV
WTPSVMQEEIQLGLGVSIKVTVISEHFCEPLTFTCDGSSTVDLLIYQTLCYAHDDLDLLD
VDDYVLKVCGQAQYLNNSQTLAGLEYIQQCLKFDWDIRLFLTKRSSVGRELARTEEDDET
PSTMNHNILLQERPIKQTVTREALTLLLDTFHNEADSFVLSEVDMPLHVERLVQSVKALC
SSLAAVETPDITLALNQLPACPCRLQPRVQKDVTVLARRENREKIVERLTAAILDLVELY
CSTFNANFHTALPSRPRTVPVQEAGMVTNVLSFSVYAAHRVPITWAASYEGFFLSCSLTH
GMNELCAPQHTSKQSVSKYLFHLVVWDQRICFPVQINQLPRESQLTVTLYATPLPPPGGA
EEKSKQKTRSMEALGWVTMPLFNFQHILTCGRKLLGLWPSTTGSGNARSSTPNFSQPDSV
ILQVDFPTSSFEVHFSTPPTAVFAPQYEFSRLDQGSQKQLQDILDKKSLFWLSPEHKRLL
WEKRHFCHADSSRLPLILASAPSWEWACLPDIYALLRHWVCTNHLDALGLLHATFPDQEC
RHTAVQWMDSISDPELLDFLPQLVQALKYECYLDSPLVRFLLCRAIGDVRIAHCLFWLLK
DALQDSQFSARYQHLLAALLCCSGRGLREEFDRQGWLVSVLAEVAQRVRDTSPSSRQTVL
KEGLEELKQFFSVSGSCRLPLNPGLLVMGINIQSCSYFNSNAVPLKLSFLNTDPLGDNIN
VIFKSGDDLRQDMLTLQVIRIMNKIWLQEGLDVRMVIFRCFSTGRGRGMVEMIPNAETLR
KIQVEHGVTGSFKDRPLADWLQKHNPTEDKYEKAVENFIYSCAGCCVATYILGICDRHND
NIMLKSSGHMFHIDFGKFLGHAQMFGNIKRDRAPFVFTSDMAYVINGGDKPSSRFHDFVD
LCCEAYNLIRKHAHLFLNLLGLMLSCGIPELSNLDDLKYVYDALRPHESEADATMHFTRL
IESSLGSVATKLNFFIHNLAQMKFASSEERPVLSFAPRVYTLKSDGRILSLFVCRHLKIC
SPNKGYTYVVKVEREGQQGTILVQRSFEEFHELHSKLRLIFPSSKLPSFPSRFVIGRSRG
EGMADRRKDELNGYVWHLIHAAPEVAQCDLVYTFFHPLPRDERPLGTGVNALNNKPTEVS
WAPVPGKVVGEVKLSISYRSDKLFIMVMHTRGLQPLQDGTDPDPYVKLYLLPDPQKTSKR
KTKAARRTCNPTYNEMLVYDRIPRGDLNQRSIHLRVLDDGAFWESTLLGETFIPLKNLTP
GQHWVDWHQLSAGGSEGSR
NT seq 4740 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcagcacagacgcagagtgacagcgagcagcgttggggctgcctggagtctctg
ggcctgagtccccgggagctggtcctggctgaggctctgcagatggagtacgatgcactc
tctcgcctcaaacaggacaagggaccacctggaacggtctcccccgacaccaggaccgaa
cgactgtcgcccagacccctccccagcccacctgggggcagtttgcacccgggtctgtcc
ggttcggatccagcactcaacctcacccagcctggagtgtcgaacccttcgaggtcaaac
ctggaatcgcgcagctacagtaaggagccactctacatcctggacactcaggggaagagc
gacaatgaggggacctccggaatgctgatgaaggggctgccacctccggacgagcctccg
ccggcagtgccgccccggaaccccgtcccgcagctggattcgttcatgacccgcaggggt
tcagctcccagagacgtgaacctgttcacccctgaggaggaccagcccaagatgccctgt
ggagataccatgaactatgacaacttaaacgactctctgatgaggctcaatgaggactgg
ccgtcacccagaaggcggaaggttaacggcgaccaattgggaaagccggttgcacgcagt
aaaaccctgcctccacaggtgccacctcgcacttacctggccggaccaaagagcaccaaa
agtacccgcagggtatcggctgacccggtgtcactgggttccaagctgaacggcttcgga
tacgagctcttccaggtgtcggaggaacgcgatgaggaggtggctgctttctgccacatg
cttgacgtgttgcgctctgcctacccatgcacggaacgctcgaagaacgccggcttcgtg
tggaccccaagtgtgatgcaggaagaaattcagctggggctcggggtcagcatcaaggtc
acggtcatcagcgagcacttctgcgaacccctcaccttcacctgtgacggatcctccacc
gttgacctgctgatctaccagacactgtgctatgcccatgatgacctggacctgctcgac
gtggacgactacgtgctgaaagtgtgcggccaggcccagtatctcaacaattctcagacc
ctggctggcctggagtacatccagcagtgcctgaagtttgactgggacatccggctcttc
ctcacgaagaggagctctgttggtagggagctcgcccgcacggaggaggacgatgagaca
ccatctaccatgaaccacaacatccttcttcaggagagacccatcaagcagactgtgacc
agggaggctctcacgttgctgcttgacaccttccataacgaggccgactcctttgtgctg
tcagaagttgatatgccgttgcatgtggagcgcttggttcagtctgtgaaggctctgtgc
agctctcttgctgccgtggaaacaccagacatcaccttagccctcaaccagctgcctgcc
tgtccctgcagactgcagcccagggtgcagaaggatgtgacggtgctggcccggagggaa
aaccgagaaaaaattgttgagaggttgacggcagccatcttggacttggtggagctgtac
tgcagcacgttcaacgccaacttccacacggcactgcccagccggccacgcacggtgccc
gtccaggaggcaggcatggtcaccaacgtgctctccttcagcgtctacgccgcccaccgc
gtccccatcacctgggccgccagttatgaaggattcttcctatcgtgttcactcacccat
gggatgaatgaactctgtgcccctcagcataccagcaaacagtcagtcagcaaatacctt
ttccatctggtggtttgggaccagaggatttgcttccctgtgcagatcaaccagctgcca
cgagaatcgcagctaacagtcaccctgtacgccacccctctaccgcccccaggaggagcg
gaagagaaaagcaagcagaaaactcgcagcatggaggctctgggctgggtcactatgccc
ctcttcaacttccaacacattctgacgtgtggcaggaagctgctcggtctgtggccttcc
acgacgggctcgggaaatgctcgctccagcacccccaacttcagccaacccgacagcgtc
attctacaggtggacttccccacatcctccttcgaagtgcacttcagcaccccccccacg
gccgtctttgctccgcagtacgagttctcccggctagaccagggcagccagaagcagctc
caggacatcctggacaagaagtccctcttctggctgtctccagagcacaagcgtctgctg
tgggagaagcgtcacttctgccatgccgacagtagccgcttaccgctcatcttggccagc
gcgcccagctgggagtgggcgtgcctgcctgacatctacgctctcctgcgccactgggtg
tgcaccaaccacctggacgccctaggcctgctgcatgccacgtttccagatcaggagtgc
agacacacagctgtccagtggatggactccatttctgacccggagttactggacttcctc
ccgcagctggtgcaggccctgaagtatgagtgctatctggacagccccctggtgcgtttc
ctgctgtgccgagccatcggagatgtgcgcatcgctcactgcctgttctggctgctgaag
gacgccctgcaggactcccagttcagcgcgcgctaccaacacctgctcgccgccctgctc
tgctgctcgggacggggcctgcgggaagagttcgaccggcagggctggctggtcagcgtc
ctggctgaagtggcccagcgcgtgcgggacacctcgccgtcgtcccgacagactgtgctg
aaggagggtctggaggagctgaagcagttcttctctgtgagtgggagctgtcgtctcccg
ctgaaccctggccttctggtgatgggcattaacatacagtcctgttcctacttcaactcc
aacgccgttccccttaagctctctttcctcaacacggatccgctgggagacaacatcaac
gtgatctttaagtcgggagacgacctgcgtcaagacatgctaacgctgcaggtcatccgc
atcatgaacaagatctggctgcaggaggggctggacgtgaggatggtcatcttccgctgc
ttttccacgggccgtggccgaggcatggtggagatgatccccaatgccgagaccctcagg
aagatccaagtggagcacggcgtcaccggctccttcaaagaccgccccttggctgactgg
ctacagaaacacaaccccaccgaggacaaatacgaaaaagctgtggagaacttcatctac
tcttgtgcaggctgctgcgtagccacctacatcctgggcatctgtgatcgccataacgac
aacatcatgctgaagagcagcggtcacatgttccacatcgacttcggcaagttcctgggc
cacgcccagatgtttggcaacatcaaacgggaccgggccccgtttgtcttcacgtcggac
atggcgtacgtgatcaatggtggagataagccgtccagccgcttccacgactttgtagac
ctgtgctgtgaggcgtacaacctgatcaggaagcacgcacacttgttcctcaacctgctg
ggtctgatgctgtcctgtggcattcctgagctgtctaatctagacgatctgaagtatgtc
tacgatgccttgcgacctcatgaatctgaggctgatgctaccatgcacttcaccaggctg
atagagtccagtctgggcagcgtggccaccaagctgaacttcttcatccataacctggcc
cagatgaagttcgcctcgtccgaggagcggcccgtgttgtcatttgcgccacgcgtctac
acgctgaagagcgacggccgtatcctcagcctgttcgtgtgccgccatctgaaaatctgc
agccccaacaagggctacacgtatgtggtgaaagtggagcgggagggccaacaggggacg
atcttggtacagaggagttttgaagagtttcatgagttgcacagcaaactgcgtctcatc
ttcccttcatctaaactgcccagcttccccagccgctttgtgattggtcgctcacgcggg
gagggcatggctgaccggcggaaagacgagctgaatggatatgtgtggcatctaatccat
gcagcccctgaggtggctcagtgtgacctggtctacaccttctttcacccattaccaaga
gacgaacgaccactagggaccggcgtaaatgcactgaacaacaaacccacagaggtgtct
tgggctccggttcctggtaaagtggtgggtgaagtgaagctctccatatcctacaggagt
gacaagctcttcatcatggttatgcacacacgtggcctgcaaccgctgcaagacgggaca
gacccggacccctacgtcaagctgtatctgctccctgatccacagaaaaccagcaagagg
aagaccaaggcagctcggcgcacatgcaaccccacgtacaacgagatgctggtgtatgat
aggataccacgtggggacctgaatcagaggtccatccaccttcgggtgttggatgacggg
gcattctgggagagtaccctgctgggcgagaccttcatccccttaaagaacctcacgcct
ggccagcactgggtggactggcaccagctaagcgccggaggctccgaaggcagccgctag

DBGET integrated database retrieval system