KEGG   Electrophorus electricus (electric eel): 113589862Help
Entry
113589862         CDS       T05787                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: glycogen [starch] synthase, muscle-like
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee00500  Starch and sucrose metabolism
eee01100  Metabolic pathways
eee04910  Insulin signaling pathway
Module
eee_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:eee00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    113589862
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    113589862
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:eee01003]
    113589862
Enzymes [BR:eee01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     113589862
Glycosyltransferases [BR:eee01003]
 Polysaccharide
  Storage polysaccharide
   113589862
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 113589862
NCBI-ProteinID: XP_026885526
Position
Unknown
AA seq 688 aa AA seqDB search
MPLARSISVTSLSGLDEWDEEFELEDAVLFEIAWEVANKVGGIYTVIQTKARLTCEEWGE
NYFLVGPYTESNVRTQVELIEPTSAVLRRTIDKMNSSGCKVYFGRWLIEGSPYVILLDVG
FTAWSLDRWKSELWENCAIGVPWFDREANDAVLFGFLTAWLLGEVCLCVCVCLCVCVCLC
VCVCVSLCLCLCVCVCVSLLFVNXFYVCIFFIYIXLPQFNVDKEAGDRQIYHRYCVERAA
ARCAHVFTTVSKITAIEAEHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHATSKARIQEFI
RGHFYGHLDFNLDKTVFLFIAGRYEFSNKGADIFLEALARLNYLLRVNHSEVTVIAFFIM
PARTNNFNVETLKGQAVRKQLWDTAHTVKERFGKKLYESLLVGQLPEVSKLLDKEDFTMM
KRAIFATQRQGLPPVCTHNMLEDSTDPILSCIRRIGLFNSAQDRVKVIFHPEFLSSTSPL
LPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVSTNLSGFGCFMEEHIADPSAY
GIYILDRRYRGVDESCNQLTTFLFQFCQQSRRQRIIQRNRTERLSDLLDWRYLGRYYVAA
RHMALAKAFPDQYMYEPHDPTSTSGFRYPRPASVPPSPAHSLHSSPHHSEGEDEEERYDE
ELEAEKDRMNIRQPYRNKSPPVDLPEKN
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atgccgttggcacgcagtatctcggtcacctctctctcgggtcttgacgagtgggatgag
gagtttgagctggaggatgcagttctgtttgagatcgcctgggaggtggcgaacaaagtg
ggaggcatctatactgtgatccagacgaaggctcggttgacctgtgaagagtggggggag
aactacttcctggtggggccctacacagagtccaatgtcaggacacaggtggagctgata
gagcccaccagtgctgttctcagacggaccatcgacaagatgaacagtagtggctgcaag
gtatattttggccgctggctgattgagggctctccatacgtgatcctgttggacgtgggc
ttcaccgcttggtctctggaccgctggaagagtgaactgtgggagaactgcgccatcggc
gtgccctggttcgatcgtgaggccaacgacgccgtcctgtttggcttcctcactgcctgg
ctgctaggagaggtgtgtctctgtgtgtgtgtgtgtctctgtgtctgtgtgtgtctctgt
gtctgtgtgtgtgtgtctctgtgtctgtgtctctgtgtctgtgtgtgtgtgtctctgttg
tttgtgaattaattttatgtgtgtatatttttcatatatatatanctcccgcagtttaac
gtggataaggaggcaggggacaggcagatctaccaccgttactgcgtggagagagcagct
gcacgctgtgctcacgttttcaccactgtgtccaagatcactgccatcgaggctgagcac
ctgctcaaaaggaaaccagatattgtgacccctaatggtctgaatgtgaagaagttctca
gctatgcatgagttccagaacctgcatgcaacctccaaggcgcgcatccaggagttcatc
aggggccacttctatgggcatttagattttaatctggataagaccgttttccttttcatc
gctggacgttatgagttctcaaataaaggagcggatatattcctcgaagctctggccaga
cttaactacctactgagggtgaaccacagcgaggttacagtcatcgcctttttcatcatg
cctgcacgaaccaacaacttcaacgtggagacactaaaaggacaagccgtacggaaacag
ctctgggatacggcccacacggtgaaggagcgctttggaaagaaactctacgagtcatta
ctagtggggcagctgccggaggtgtccaagttgttggataaggaggacttcactatgatg
aagagagctatctttgctactcagcgccaaggtctgccgcctgtctgcacccacaacatg
ctggaggacagtacagaccccatcctgtcctgtatccgccggataggtctgttcaacagt
gctcaggacagagtgaaggtgatctttcatcctgagttcctgtcctctacatctccgctc
ctgcccatggactacgaggagtttgtcagaggttgtcacctgggagtcttcccctcttac
tatgagccctggggatacacacctgctgagtgcacagtcatgggtatcccatctgtctcc
accaacctctctggctttggttgcttcatggaggagcacatcgcagacccctcggcgtac
gggatctacattctggaccgccgctatcgtggggtagatgagtcctgtaatcagttgacc
actttcctgttccagttctgccagcagagccgcagacagcgtatcatacagaggaaccgc
acggagcgtctgagtgacctgctggactggagatacctgggccggtactacgttgctgcg
cgtcacatggccctcgccaaggcgttccctgaccagtacatgtatgaaccacatgacccg
acctcgacctcaggattccgttacccccgacccgcctcggtacccccatccccagcacac
tcgctccactcctcccctcaccacagtgaaggtgaggatgaggaggagcgctacgatgaa
gaactggaggcggagaaagaccgcatgaacatccgccagccctacaggaacaagagtcca
ccagtagacctgcctgagaaaaactaa

DBGET integrated database retrieval system