KEGG   Electrophorus electricus (electric eel): 113590829Help
Entry
113590829         CDS       T05787                                 

Gene name
cacng5
Definition
(RefSeq) voltage-dependent calcium channel gamma-5 subunit
  KO
K04870  voltage-dependent calcium channel gamma-5
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee04010  MAPK signaling pathway
eee04260  Cardiac muscle contraction
eee04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:eee00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113590829 (cacng5)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    113590829 (cacng5)
   04261 Adrenergic signaling in cardiomyocytes
    113590829 (cacng5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:eee04040]
    113590829 (cacng5)
Ion channels [BR:eee04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   113590829 (cacng5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Claudin_2 PMP22_Claudin DUF716 DUF4199 DHHC
Motif
Other DBs
NCBI-GeneID: 113590829
NCBI-ProteinID: XP_026886938
Position
Unknown
AA seq 275 aa AA seqDB search
MSMCGRKALTLLSSVFAVCSLGLLGIAVSTDYWLYLEEGIIQPLNQSTEIRTSLHSGLWR
VCFLAGKEKGRCFTIEYVMPMNVQLTSDSTVSVLKMIRSATPFPLVSLLFMFVGFVLNNI
GHIRPHRTILAFVSGIFFILSGLSLVVGLVLYISSINDEILNRTKTNEAYFSYKYGWSFA
FAAFSFLLTEAAGVMSVYLFMKRYTAEELYRPHPGFYRPRLSNCSDYSGQFLHPDAWGRG
RSPSDISSEASLQMSSNYPALLKCPDYDQMSSSPC
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgagcatgtgcggcaggaaggccctgacgctgctcagcagtgtgttcgccgtgtgcagc
ctcggcctgctgggcatcgccgtcagcacggactactggctctacctggaggagggcatc
atacagccactgaaccagagcacggagatccgcacgtccctgcactctggcctgtggagg
gtttgcttcctggcaggaaaagagaaaggacgctgctttaccatcgagtacgtcatgccc
atgaacgtccaactgacttcagactctacagtcagcgttctgaagatgatacgctcagcc
actccattcccactggtcagcctcctcttcatgttcgtcggttttgtcctgaacaacatt
ggacacattcgcccccaccgcaccatcctggcctttgtctctggaatcttcttcatcctc
tcagggctttctctggtggttggtctggtgttatacatctctagcatcaatgatgagatt
ttgaacaggactaagacaaacgaagcctacttcagctacaagtacggctggtccttcgct
ttcgctgccttctccttcctgcttaccgaggcagcaggtgtgatgtctgtttacctgttc
atgaagcgctacacagcggaggagctgtaccggccacacccgggcttctaccggccacgc
ctgagcaactgctccgactactcgggccagttcctccaccctgatgcttggggccgtggc
cgcagcccctcggacatctccagtgaagcgtcgctccagatgagctccaactaccccgcc
ctgctcaaatgccccgactatgaccagatgtcctcctccccctgctga

DBGET integrated database retrieval system