KEGG   Eubacterium eligens: EUBELI_00490
Entry
EUBELI_00490      CDS       T00908                                 

Definition
(GenBank) cysteinyl-tRNA synthetase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
eel  Eubacterium eligens
Pathway
eel00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:eel00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    EUBELI_00490
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:eel01007]
    EUBELI_00490
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:eel03016]
    EUBELI_00490
Enzymes [BR:eel01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     EUBELI_00490
Amino acid related enzymes [BR:eel01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   EUBELI_00490
Transfer RNA biogenesis [BR:eel03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    EUBELI_00490
 Prokaryotic type
    EUBELI_00490
SSDB
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g DALR_2 tRNA-synt_1 tRNA-synt_1f YihI tRNA-synt_1d
Other DBs
NCBI-ProteinID: ACR71504
UniProt: C4Z3N5
Position
497960..499378
AA seq 472 aa
MRIYNTLSRRKEEFKPLEEGKVKMYVCGPTVYNLIHIGNARPMIVFDTVRRYLEYKGYDV
NYVSNFTDVDDKIIKKANEEGVSAEEISTRYIAECKKDMEGMNIKPATTHPLATQEIGGM
IDMIQTLIDKGYAYEVNGTVYYRTRKFAEYGKLSKKNIDDLEAGHRDEAHSLKVTGEDEK
EDPLDFVLWKPKKEGEPSWPSPWSDGRPGWHIECSVMSKKYLADEIDIHAGGEDLIFPHH
ENEIAQSEAANGVPFSKYWMHNAFLNIDNKKMSKSLGNFFTVRDISREYDLEVLRFFMLS
AHYRNPVNFSHDLMESAKNGLDRILTAVDNLRHLSENAKDVIMTEDEKKIIASIDDIYKK
FEDSMDDDFNTADAISAIFELVKLANSNSSSDNSKEYIDTLMKKITTLTDILGLKTDKKE
EMLDEDIEALIAERQQARKDKNFARADEIRDELLAKGIVLKDTREGVRWSRA
NT seq 1419 nt   +upstreamnt  +downstreamnt
atgaggatttataatactttatccagaagaaaagaagagtttaagccattagaagaaggt
aaggttaaaatgtatgtctgcggacctactgtatacaaccttattcatattggtaacgca
agacctatgattgtatttgatacagtaagaagatatcttgagtacaagggatatgatgtt
aattatgtatctaactttacagatgtagacgacaagattattaagaaagctaatgaagaa
ggtgtatctgctgaggagatttcaacaagatacattgctgaatgtaagaaggatatggag
ggcatgaatattaagcctgcaacaacacatcctcttgcaactcaggaaatcggtggaatg
attgatatgatacagactcttattgacaagggttatgcttatgaagtcaatggaaccgta
tactacagaacaagaaagtttgcagaatacggaaagctatctaagaagaatattgacgac
ttggaggcaggacacagagatgaggcacatagtcttaaggttacaggtgaggatgagaag
gaagacccacttgatttcgttctttggaagcctaagaaagaaggagagccatcttggcca
tcaccttggagtgacggaagaccaggctggcatattgaatgctctgttatgtctaagaag
tatcttgctgacgaaatcgatattcatgcaggtggagaggatttaatattccctcaccat
gagaatgagattgcacagtcagaggcagctaatggagtaccattctctaagtactggatg
cacaatgcatttcttaatattgataacaagaagatgtctaagtctttaggcaatttcttt
acagtaagagatataagcagggaatatgaccttgaagtgttaagattcttcatgttaagc
gcacattaccgcaatcctgttaatttcagtcatgaccttatggaatcagcaaagaacgga
ttagacagaatcttaactgcagttgataatttaagacatctgtcagagaatgccaaagat
gttataatgacagaggatgagaagaagataatagcttctatagatgacatttataagaaa
ttcgaagattcaatggacgatgatttcaatacagcagatgcaatatcagctatatttgaa
cttgtaaagcttgctaactctaattcaagctcagataattccaaggaatacatcgatact
cttatgaagaagattacaactctcacagatattcttggacttaagacagacaagaaggaa
gaaatgcttgatgaggatatcgaggcacttattgccgagagacagcaggcaagaaaagat
aagaattttgcaagagctgatgaaattagagatgagttattagcaaagggaattgttctt
aaggatacaagagagggcgtaagatggagcagagcctag

DBGET integrated database retrieval system