KEGG   Eubacterium eligens: EUBELI_00924Help
Entry
EUBELI_00924      CDS       T00908                                 

Definition
(GenBank) oxaloacetate decarboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
eel  Eubacterium eligens
Pathway
eel00620  Pyruvate metabolism
eel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EUBELI_00924
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eel02000]
    EUBELI_00924
Enzymes [BR:eel01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     EUBELI_00924
Transporters [BR:eel02000]
 Other transporters
  Primary active transporters [TC:3]
   EUBELI_00924
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like DUF2564
Motif
Other DBs
NCBI-ProteinID: ACR71925
UniProt: C4Z5R6
Position
939186..940604
Genome map
AA seq 472 aa AA seqDB search
MAEQVKKPLKITETVLRDAHQSLIATRMTTEQMLPIVDKMDKVGYHSVECWGGATFDASL
RFLKEDPWERLRKLRDGFKNTKLQMLFRGQNILGYNHYADDVVEYFVQKSIANGIDIIRI
FDCFNDLRNLETAVKAAKKEKGHAQIALSYTLGDAYTLDYWKETAKRIEDMGADSICIKD
MAGLLLPYKATELVQALKDGSSLPIQMHTHYTSGVASMTYLKAVEAGADIIDTAMSPFSM
GTSQPATEVMVETFKGTQYDTGLDQNLLAEIADYFQPMREEALKSGLMNTKVLGVNIKTL
LYQVPGGMLSNLVSQLKEAGAEDKYRDVLEEIPRVRKDYGEPPLVTPSSQIVGTQAVLNV
LQGERYKMITKESKKVLAGEFGQTIKPFNPEVQKKAIGDTKPITCRPADLIEPQLEKFKN
DPIVQQYKQQDEDVLSYALFPQVATEFFKYREAQQTKVDPTKADTANKAYPV
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggcagaacaggttaaaaaacctttaaagattactgagacagtattgcgtgatgcacat
cagtctcttatagctacaagaatgacaacagagcagatgcttcctatcgtagataagatg
gataaggttggttatcattcagtagagtgctggggaggagctacatttgatgcttcactc
agattccttaaggaagatccatgggaaagacttcgtaagcttagagatggattcaagaat
actaagcttcagatgcttttcagaggacagaatatattaggttacaatcattacgcagat
gatgtagttgagtactttgttcagaagtcaattgctaacggtattgatattatccgtatt
ttcgattgctttaatgatttaagaaacttagagacagctgttaaggctgccaagaaggaa
aaaggacatgctcagattgctctttcttatacattaggtgatgcttatacacttgattac
tggaaagagacagctaagagaattgaagacatgggtgcagattctatctgcatcaaggat
atggctggacttttgcttccatacaaggctacagagcttgtacaggcattaaaggatggt
tcatctcttcctattcagatgcatacacattatacatctggtgtagcttcaatgacatac
ttaaaagcagtagaagcaggtgctgatattattgatacagctatgtcaccattctcaatg
ggaacatcacagccagctacagaggttatggtagagacatttaagggtacacagtatgat
acaggacttgaccagaatcttcttgctgagatagctgattacttccagccaatgcgtgag
gaagcattaaagagcggacttatgaatactaaggttcttggagttaatattaagacatta
ctttatcaggttccaggtggaatgctttctaaccttgtatcacagcttaaggaagctggt
gcagaggacaagtacagagatgtattagaggaaatcccaagagttcgtaaagattatggt
gaaccacctcttgttactccttcatcacagattgttggtactcaggctgttcttaatgta
ttacagggtgagagatacaagatgattactaaggaatctaagaaggttcttgctggtgaa
tttggtcagacaatcaagccattcaatccagaagttcagaagaaggctatcggtgataca
aagcctattacatgccgtccagctgacttgattgaaccacagcttgagaaattcaagaat
gatccaattgtacagcagtacaagcagcaggatgaggatgtgctttcatatgcattattc
ccacaggttgcgacagagttcttcaagtatagagaagctcagcagacaaaggttgatcct
acaaaggcagatacagctaataaggcttatccagtctaa

DBGET integrated database retrieval system