KEGG   Eubacterium eligens: EUBELI_01169Help
Entry
EUBELI_01169      CDS       T00908                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
eel  Eubacterium eligens
Pathway
eel00010  Glycolysis / Gluconeogenesis
eel00020  Citrate cycle (TCA cycle)
eel00620  Pyruvate metabolism
eel01100  Metabolic pathways
eel01110  Biosynthesis of secondary metabolites
eel01120  Microbial metabolism in diverse environments
eel01130  Biosynthesis of antibiotics
eel01200  Carbon metabolism
Module
eel_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:eel00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EUBELI_01169
   00020 Citrate cycle (TCA cycle)
    EUBELI_01169
   00620 Pyruvate metabolism
    EUBELI_01169
Enzymes [BR:eel01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     EUBELI_01169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP DUF4914 AAA_33
Motif
Other DBs
NCBI-ProteinID: ACR72169
UniProt: C4Z0Q6
Position
complement(1182141..1183745)
Genome map
AA seq 534 aa AA seqDB search
MAKIDLSKYGITGATEIVYNPSYELLFEEETKSTNEGYEVGKESELGAVDVMTGIYTGRS
PKDKYIVVDENSKDTVWWTSDEYKNDNHPMSEDVWAKVKDIAKAELSNKKLFVVDAFCGA
NKDTRMAVRFIVEVAWQAHFVTNMFIKPTAEELENFEPDFVVYNASKAKVENYAELGLNS
ETCVAFNITSHEQVIINTWYGGEMKKGMFSMMNYYLPLKGIASMHCSANTDKNGENTAIF
FGLSGTGKTTLSTDPKRLLIGDDEHGWDDNGVFNFEGGCYAKVINLDKDSEPDIYNAIKR
NALLENVTLDENGKIDFADKSVTENTRVSYPINHIENIVRPISSAPAAKNVIFLSADAFG
VLPPVSILTPEQTQYYFLSGFTAKLAGTERGITEPTPTFSACFGQAFLELHPTKYAAELV
KKMEKSGAKAYLVNTGWNGTGKRISIKDTRGIIDAILSGAINTAPTKKIPMFNFEVPTEL
PGVDPAILDPRDTYADASEWETKAKDLAARFNKNFVKYTGNEAGKALVAAGPQL
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaatcgatttaagcaagtatggcatcacaggtgctacagagatcgtctacaat
ccttcttatgaattattattcgaggaagagactaagtctactaacgaaggttatgaagtt
ggtaaggaaagcgaacttggagctgttgatgttatgacaggtatctatacaggtcgttct
cctaaagacaagtacattgttgttgatgagaactctaaggacactgtatggtggacatca
gatgagtataagaacgataaccacccaatgtcagaagatgtatgggctaaggttaaggac
atcgctaaggcagagctttctaataagaaacttttcgtagttgatgcattttgtggagct
aacaaggacacaagaatggcagttcgtttcatcgttgaagttgcttggcaggcacatttt
gtaactaatatgttcattaagccaacagcagaagaacttgagaacttcgagccagatttc
gttgtatataatgcttctaaggctaaggttgagaactatgctgaattaggccttaactca
gagacatgtgttgcattcaacattacaagccatgagcaggtaatcattaatacatggtat
ggtggagagatgaagaagggtatgttctctatgatgaactactaccttccattaaagggt
attgcttcaatgcactgctcagctaacacagataagaacggagagaatacagcaatcttc
tttggtctttcaggaacaggtaagacaacactttcaacagatcctaagagactccttatc
ggtgatgatgagcatggttgggatgacaatggcgtattcaacttcgaaggtggatgctac
gctaaggttatcaaccttgataaggactcagagccagatatctacaatgcaattaagaga
aacgctcttcttgagaacgttacacttgatgagaatggaaagattgattttgcagataag
agcgtaacagagaatactcgtgtatcttacccaatcaatcatattgagaatatagtaaga
ccaatttcttcagctccagcagctaagaatgtaatcttcctttcagcagatgctttcgga
gtacttcctccagtatctattcttacaccagagcagacacagtactacttcctttcagga
tttactgctaagcttgctggtacagagagaggaatcacagagcctacacctacattctca
gcttgcttcggacaggcattccttgagcttcatcctacaaagtatgcagcagagcttgtt
aagaagatggaaaagagtggagctaaggcttacttagttaacacaggatggaatggaaca
ggtaagagaatctctattaaggatactcgtggtatcattgatgctatcctttcaggtgct
attaatacagctccaacaaagaagattcctatgttcaactttgaagttcctacagagctt
cctggagtagatccagcaatccttgatccaagagatacatatgctgatgcttctgagtgg
gagactaaggctaaggatcttgctgcaagattcaataagaactttgttaagtacacaggt
aacgaagctggtaaggctttagttgctgctggtccacagctttaa

DBGET integrated database retrieval system