KEGG   Eubacterium eligens: EUBELI_01848Help
Entry
EUBELI_01848      CDS       T00908                                 

Definition
(GenBank) Glycoside Hydrolase Family 2 candidate b-galactosidase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
eel  Eubacterium eligens
Pathway
eel00052  Galactose metabolism
eel00511  Other glycan degradation
eel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eel00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    EUBELI_01848
  Lipid metabolism
   00600 Sphingolipid metabolism
    EUBELI_01848
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    EUBELI_01848
Enzymes [BR:eel01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     EUBELI_01848
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C Bgal_small_N Glyco_hydro_2_N DUF4981 Glyco_hydro_2 Bac_rhamnosid_N BetaGal_dom4_5
Motif
Other DBs
NCBI-ProteinID: ACR72837
UniProt: C4Z412
Position
complement(1907551..1910613)
Genome map
AA seq 1020 aa AA seqDB search
MNEGGVFMIVPRYYEDLSVLHDNTMLARAYYMPASKRMDDLVEHRELSDRMQLLNGTWKF
QYFDSIYDMKDAFYEDGYSVESFDEIAVPSVWQMAGYDTHQYTNIRYPFPFDPPYVPQDI
PCGAYVHTFDYARDDAAPKAYLNFEGVDSCFYVWLNGTYVGYSQVSHMTSEFDVTDVLRE
GENRISVLVMKWCDGSYLEDQDKFRMSGIFRDVYLLKRPEKAIRDYHITTELDADIAKID
LTVSFHEPVEVRVKIEDKNGAVVSEGVIDKNGKATFEIVDYKLWNTENPYLYTIIFETEQ
EVIVDHIALRKIEIKDQVIYLNGQKIKFRGVNRHDSDPVTGFTISMEQIKIDLTLMKQHN
FNAIRSSHYPNAPFFYEMCDRYGFMVIDEADIEAHGPFMLYRKEDTDYNRFKRWNEKIAD
DPAWEAAIVDRVKLMVERDKNRFCIVMWSMGNESAYGCNFEKALAWTKEFDPERITQYES
ARYRNYDVTYDYENLDLYSRMYPALTEIEEYLEKDGSKPFLLVEYCHSMGNGPGDFEDYF
QMIQAEDKMCGGFVWEWCDHAIVHGVAENGKTIYAYGGDHGEVIHDSNFCMDGLVYPDRR
IHTGLLEYKNVYRPARVVSYDAASGELVLHNYMDFDDLKDYAEITYELSQDGLVIGKGKL
SEVSILPHCDGSTTLKLSIPENGKVYLKLFYKLKKDIPLLSKAYVLGFDEIDVSSKGAKN
QQALSWLTKEVPDTRIQVQENDTEINIKGREFSYIINKRTALFDSLIFAGREYLKNPMEL
NIWRAPTDNDMYIKAEWRKAHYNEAYTRAYNSEVIQGKHGVTVVSQASVVAPTVQKILDV
TLIWTIDAAGRIGADIAVKKNDEFPDLPRFGVRMFLDKKLTDAGFFGMGPQESYRDKHRA
ASHGLYRLKVSDMHEDYIRPQENGSHYDCDYVELGNSQYGITAIAEEDAFSFNASFYTQE
ELEKKAHNYELIESDSTVLCLDYAQNGIGSNSCGPDVLDAYRFDDRLFRFRFTLVPYVKG
NT seq 3063 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaggaggggtatttatgatcgtgccacgttactatgaggatttaagcgtatta
catgacaatacgatgctggcaagagcctattacatgccggcttcaaagcggatggatgac
ttggtagagcacagagagctgtcagacagaatgcagcttttgaatggtacatggaagttt
cagtattttgacagtatttatgatatgaaggatgccttttatgaggatggttattcggtt
gagagctttgacgagattgcagttccgagtgtatggcagatggcaggttatgatacacat
caatacacaaatatccgttatccatttccgtttgatccgccatatgtgccacaggatatt
ccatgtggagcttatgtgcatacctttgactatgcaagggatgatgcagcaccaaaggca
tatcttaactttgaaggtgtggatagctgcttttatgtatggttaaacggcacctatgta
ggttacagtcaggtgagccacatgaccagtgagtttgatgtgacagacgtattgcgggaa
ggagagaaccggatttctgtgcttgtgatgaagtggtgcgacggttcgtaccttgaggat
caggacaagttccgtatgagtggaatttttcgtgatgtttatcttttaaagcgtccggaa
aaggcaattcgagattatcatattacaacagaattggatgcagacattgcaaagatagat
cttacagtaagctttcatgaaccggtagaggttcgggtaaagatcgaggataagaatggc
gcagttgtttccgagggagtgattgacaaaaacggtaaagctacttttgagattgttgac
tataagctctggaatacagagaatccttatctttacactattatttttgagacagagcag
gaggtgattgtagatcatatagcactccgcaagatagaaatcaaagatcaggtaatctac
ttaaacggacagaagatcaagtttcgtggtgtgaaccgccatgattccgatccagttact
ggctttacaatcagcatggagcaaatcaagatagatcttaccttgatgaagcagcataac
ttcaatgcaatccgttccagccattatccaaatgcaccatttttttatgaaatgtgcgac
cgctatggatttatggtgatcgacgaggcagatattgaagcacacggaccatttatgctg
tatcgaaaagaggatacggattacaaccgctttaagcgttggaatgagaagatagcagat
gatccggcatgggaagctgcgattgttgaccgtgtgaagctgatggtggagcgtgacaag
aaccggttctgtatcgtgatgtggtctatgggaaatgaaagtgcttatggctgcaatttt
gagaaggcactggcatggacaaaggaatttgatccggagcggatcacgcagtatgagagt
gccagataccgtaattacgatgtaacctatgattacgagaatctggacttatacagccgt
atgtatccggcgcttactgagatagaggaatacctggaaaaggatggtagcaaaccattc
cttctggtggaatactgccacagtatgggaaatggtcctggagattttgaagattatttc
cagatgatacaggcagaggataagatgtgcggtggtttcgtgtgggagtggtgcgatcat
gcaatcgtccatggtgtagccgaaaatggcaagacgatatatgcctatggtggcgatcat
ggcgaagtaatccatgacagcaacttctgtatggatggtctggtatatccggacagaagg
atacacaccggacttttggagtacaagaatgtataccgaccggcaagagtagtatcgtat
gatgcagcaagtggagaattagtgcttcacaactatatggattttgatgatctgaaggat
tatgcagagattacttatgagttgtcacaggatgggcttgtaatagggaaggggaagctt
tccgaagtatccattttaccgcattgtgatggaagtacaaccttaaagctttcaatcccg
gagaatggaaaggtatatctgaagctgttctataagctgaagaaggacatcccgcttctt
tccaaggcgtatgtcttaggctttgatgagatagatgtaagcagtaagggtgcaaagaat
cagcaggcattaagctggcttacaaaggaagtaccggatacccgtattcaggtgcaggag
aatgatacagagatcaacataaagggacgagagttttcctatataatcaacaaacggaca
gcactttttgacagtttaatatttgcaggcagagaatatctgaagaatccgatggaactg
aatatctggagagcgccgacggataatgatatgtatatcaaggcggagtggaggaaagca
cactacaatgaagcatatacaagagcatataattcagaggtgattcaaggaaagcacgga
gtgactgttgtaagtcaggcttcggttgtagcaccaaccgtgcagaagattcttgatgtg
acactcatatggacgattgatgcagccggaagaattggagctgatatcgcagtgaaaaag
aatgatgaattccctgatcttccaagatttggtgtgaggatgttcttagataagaaactt
acagatgcagggttcttcggtatgggaccgcaggaaagctaccgggacaagcatagagca
gcaagccatggattgtatcgtcttaaggtttcagatatgcatgaagattatattcgtcca
caggaaaacggaagtcactatgactgtgattatgtggagcttggcaacagccaatatggt
atcacagctatagcagaagaagatgcattttcattcaatgcctctttctatacgcaggag
gagttggagaaaaaagcacataattatgaacttatagaatcggacagtacggtactctgt
cttgattatgcacagaatggaataggctctaacagttgcggaccagacgtgttagatgcg
tacagatttgatgatagattattccggttccggtttacactggttccgtatgtgaaggga
taa

DBGET integrated database retrieval system