KEGG   Eubacterium eligens: EUBELI_01884Help
Entry
EUBELI_01884      CDS       T00908                                 

Definition
(GenBank) sulfate transport system permease protein
  KO
K02047  sulfate/thiosulfate transport system permease protein
Organism
eel  Eubacterium eligens
Pathway
eel00920  Sulfur metabolism
eel02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:eel00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    EUBELI_01884
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    EUBELI_01884
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eel02000]
    EUBELI_01884
Transporters [BR:eel02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Sulfate/thiosulfate transporter
    EUBELI_01884
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ACR72873
UniProt: C4Z448
Position
complement(1948045..1948890)
Genome map
AA seq 281 aa AA seqDB search
MNIRKDSGPLKWILIGISVLFLFVMLILPLSYVMYTAFSKGIKVFLAAVTDKYALHSIKL
TIEVSLIAVVCNTFFGIFASWLITKFQFKGKKIISTLIDLPLTVSPIIAGLIYVLTFGRQ
SFIYPYLKAMGVRIIFAVPGIVLATIFVTFPFISRELIPVLTSQGTDEEEAAALMGANGW
TIFWKVTFPHIKWPLLYGIVLCTARAMGEFGAVSVLSGHLRGRTNTMPLYIELLYQGYDF
TGAFAVSAILVLMAVIILVLRSVLEYKGQQAAKAEKERQEG
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcagaaaagattcaggtccgttaaaatggattctaataggtataagtgtgttg
tttttatttgtgatgcttattctgcccctcagctatgtaatgtatacagcattttctaag
ggcataaaggtgtttctggcagctgttaccgacaaatacgcacttcattcgattaagctg
acaatagaggtttcgcttattgcggttgtgtgtaacacatttttcggaatatttgcttca
tggcttattacgaaattccagtttaagggcaagaagattatatctactttaatagattta
ccactcacagtttcaccgattatagcaggtcttatatatgtgcttacattcggtagacag
agttttatatatccatatcttaaggctatgggagtaagaattatattcgcagttccgggt
atcgtgcttgcgactatatttgtaacgtttccattcatatcaagggagctgataccggtt
cttacctcgcagggaactgacgaggaggaggctgcagcgcttatgggtgcaaatggctgg
actatattctggaaggttacattcccacatatcaaatggccgcttctctacggtattgta
ctgtgtacagcgagagcaatgggcgagtttggcgcggtatccgttctttcaggacatttg
cgcggaagaactaacacgatgccgttgtatattgaacttctgtatcagggatatgatttt
acgggagcatttgcagtgtcagcaattcttgtgctgatggcggttattatacttgtgctt
cgaagtgtacttgaatacaaggggcagcaggcagctaaggcagagaaagagcggcaggaa
ggatag

DBGET integrated database retrieval system