KEGG   Elizabethkingia anophelis JM-87: BBD30_15975Help
Entry
BBD30_15975       CDS       T04743                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
een  Elizabethkingia anophelis JM-87
Pathway
een00040  Pentose and glucuronate interconversions
een00053  Ascorbate and aldarate metabolism
een01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:een00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BBD30_15975
   00053 Ascorbate and aldarate metabolism
    BBD30_15975
Enzymes [BR:een01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     BBD30_15975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AQW95568
Position
3516518..3517999
Genome map
AA seq 493 aa AA seqDB search
MIEETSFQLIDQKVRQAADAYQFLKNTTIKGRSAFMNAVADKIEGLGEHLLTTAHTETSL
PLARLTGEKARTIGQWRSYAKAVSTGIYTEARIDLPQASQSKGDLRKYNVGLGPVVVFGA
SNFPFAFSTAGGDTASAIGAGCPVIVKAHPAHPETSQIMADAITEVVKEFGWPEGVFIHI
TGKSNDIGAYLIQHKEIKAAAFTGSFAGGKALFDLGSQRKEPIPVFAEMGSINPVFAFQN
QLSVKAEQLAKEYAASLTLGVGQFCTNPGIFIAEAGDSFERFKVALRNEILNVIPVNMLH
KGIFENFEKYKKLVCSQPDVSIISEVNSEIKEWEGRAIVIETTAANFIKNNILSEEVFGP
FGIIVKCNSRDEMLQIAQQLQGQLTITIAATNEDVHLNIDIINVVKDKCGRLLFNGMPTG
VEVVYAMHHGGPYPSTTDPRFTSVGSDAVKRFVRPITFQNWPDEFLPEELKNENTLQISR
IVDGEIHSGSLKN
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgattgaagaaacatcttttcagttaattgatcagaaagtccggcaggctgctgacgcc
tatcagtttctgaaaaatacaacgataaaagggcgttcagcatttatgaatgctgttgct
gacaaaattgaaggattaggtgagcatttgcttaccactgcacatacagaaacctctttg
cctttagcccgattgaccggagaaaaagcaaggactataggccaatggagaagttatgct
aaagctgtgtctaccggaatttatacagaagccagaatagatcttccacaagcttcccaa
tcaaaaggagatttacgtaaatacaatgttggcttgggtcctgttgtcgttttcggagcc
agtaattttccgtttgcattttctacagctggcggcgatactgccagtgctattggagca
ggttgtcctgttattgtaaaagcacatcctgcacatcctgaaacatcacaaataatggca
gatgcaataacagaagttgtaaaagaatttggatggccggaaggtgtattcattcatatt
acagggaaatctaacgatattggtgcttatttaatccagcataaagaaataaaagcagcg
gcatttaccggttcttttgcaggaggaaaggccttgtttgatttggggagtcagcgtaaa
gagcccatccccgtatttgcagagatgggtagcataaatcctgtgtttgcatttcagaat
cagctaagtgttaaagctgaacaactggctaaagaatatgctgcatcattaactttaggt
gtcggacagttttgtaccaatcccgggatattcattgccgaagctggtgatagttttgaa
cgtttcaaagttgcacttcggaatgaaattctgaatgtgatacctgttaatatgttgcat
aaaggaatttttgaaaactttgaaaaatataaaaaactggtttgctctcagcccgatgtt
tctattatttcagaagttaattcagaaattaaggaatgggaaggacgcgctattgttata
gagacaacggcagcgaactttattaaaaacaatattttaagtgaagaggttttcggtcca
tttggaatcattgtaaaatgtaattccagagatgaaatgcttcagattgcacaacagtta
caaggacaattaactattactattgcagcaactaatgaagatgtacacctgaatattgat
ataataaatgttgtaaaagataaatgcggaagacttttattcaacggaatgccaacgggt
gtagaagttgtttatgcaatgcaccatggtggtccttatccttcgactactgatccgcgt
ttcacatctgttggatcagatgctgtgaagcgatttgttcgcccaataactttccagaat
tggccggatgaatttttaccggaagaactgaagaacgaaaatacactgcaaattagccgg
attgttgatggagaaatacattcaggatcattaaaaaattaa

DBGET integrated database retrieval system