KEGG   Elizabethkingia anophelis JM-87: BBD30_17465
Entry
BBD30_17465       CDS       T04743                                 

Definition
(GenBank) flavastacin
  KO
K20138  flavastacin [EC:3.4.24.76]
Organism
een  Elizabethkingia anophelis JM-87
Brite
KEGG Orthology (KO) [BR:een00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:een01002]
    BBD30_17465
Enzymes [BR:een01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.76  flavastacin
     BBD30_17465
Peptidases and inhibitors [BR:een01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   BBD30_17465
SSDB
Motif
Pfam: Astacin RicinB_lectin_2 Ricin_B_lectin DUF3810 Reprolysin_5 Peptidase_M91 NUC153
Other DBs
NCBI-ProteinID: AQW95836
Position
complement(3836788..3838119)
AA seq 443 aa
MTRKLLILSGCLLLALNSCKTDIESSPANSIDHTTSQLNGTTIHKLLINGAYTYVNEVNG
EYFYADDITITAEQFNQLKRMANPDISTVERSTIVSSFIKTWPNATVYYTLPSQGSLSTQ
AYNTFLTNINKAFDMISSKTSVKFIQRTNQTEYITFTYSTGNSSPLGWVKNRVNGIKIYN
TTYPAIIAHEIMHSMGIMHEQCRPDRDQYIIVDTNRAQEGSRHNFNLYNDYAGHGEFDFG
SVMMYKSTDFAIDPNLPVMTKLDGSTFGKQRDGLSAGDYAGINHLYGPVNSTSATNGTYT
LTTSLAGDKNVDITGSSTADGTDVILYSATTGNNQKFIFRKSDHGYFTIKSILDSTKVLT
VRNNGTANGTAVELRTNADTDSQKWLLFNLGNEGFGFAPKNAPSLRLEVKDGLTTNLTPI
VIGSTDQTLQPYTKQRFKLTKVN
NT seq 1332 nt   +upstreamnt  +downstreamnt
atgacacgtaaactattaatcttatcaggctgcctgcttttggctctgaattcttgtaag
acggatatagagagttctccagctaattctattgatcatacaacaagccagctgaacgga
acaaccattcacaaattattaatcaacggagcctacacctatgtaaatgaagtcaatggc
gagtacttttacgctgatgatattacaatcacagcggagcaatttaaccagttgaaaaga
atggccaacccggatatatctacagttgagcgtagtacaattgtaagttcttttatcaaa
acatggccaaatgccacagtttattacaccttaccaagccagggaagtttaagtactcag
gcttacaatacattccttacaaacattaataaggcgtttgatatgatctcttcaaaaacc
agtgttaaattcattcaacgtaccaatcagacagaatatattacatttacttattctaca
ggaaacagctctccactgggttgggtaaaaaacagagtaaatggtattaaaatatacaat
acaacctatcctgccattattgcgcatgagataatgcactcaatggggattatgcacgag
cagtgccgtccggacagagatcagtatattatagtagataccaacagagcgcaggaaggt
tcccgccacaatttcaatctttataacgattacgcaggacacggagagtttgactttggt
tcggtgatgatgtataaatctacagattttgcaatagatcctaatctgcctgtgatgaca
aaactggatggttctacatttggtaagcaaagagatggcctgtctgctggtgattatgca
ggaatcaatcatttgtatggacctgtaaactccacatctgctactaacggtacgtataca
ctaacaacttctttagcaggtgacaaaaatgttgatattaccggaagttcaacagctgat
ggtacggatgtaatcctttattctgcaacgacaggaaacaatcagaaatttatcttccgt
aaatcagatcatggttattttactattaagtcgatactggattctacaaaagtattaacg
gtaagaaataacggaactgcaaacggaactgctgtagagctaagaaccaatgcggatacg
gatagtcagaaatggttgttatttaatttaggaaatgaaggttttggctttgctcctaaa
aatgcaccatctttaagattagaagtaaaagatggtctgacaaccaatcttacacctatt
gttattggcagtacagatcagacacttcagccttacacaaaacagcgctttaagcttaca
aaagtaaactaa

DBGET integrated database retrieval system