KEGG   Elizabethkingia anophelis JM-87: BBD30_18430Help
Entry
BBD30_18430       CDS       T04743                                 

Definition
(GenBank) inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
een  Elizabethkingia anophelis JM-87
Brite
KEGG Orthology (KO) [BR:een00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BBD30_18430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AQW96005
Position
4059676..4060812
Genome map
AA seq 378 aa AA seqDB search
MDFPILLIVIIALALIFDYINGFHDAANSIATIVSTKVLTPFQAVLWAALWNFAAFFLAA
YVIGEFKIGNTIAKTVNENFITLEVIFAGLIAAIAWNLLTWWFGIPSSSSHTLIGGFLGA
ALMHAFVTDYNQIAAAQPGLGFFETLSLAFKQLTTQGVVKFNVVIPIFLFIFLAPFIGMV
ISIIITLIIVHLYKRSNPHKADQAFKKLQLASSALFSLTHGLNDAQKVMGIIGAAVIFYH
VNILQDGYSAMPSADRFNYFAQHYLWVPLVSFLAIALGTMSGGWKIIKTMGTKITKVTPL
EGVSAETAGALTLFITEYLAIPVSTTHTITGSIIGVGLTKRVSAVRWGITVSLLWAWILT
IPISAIVAAIAYLIVILF
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggattttcctattttactaatagttattattgctttagcattaatctttgattatatc
aatggttttcatgacgcagccaattctattgctacaattgtatccacaaaagtattaacg
ccttttcaggccgtattgtgggcagcattatggaattttgcagctttcttccttgcagca
tatgtaataggagaatttaaaatcgggaataccattgctaaaacggttaacgaaaatttc
attactctcgaagtaatttttgcaggacttattgctgctatagcatggaacctgcttacc
tggtggttcggaatcccttcctcttcatcacatactcttatcggaggtttcttaggtgct
gctctaatgcatgctttcgttacagattacaatcagatagctgcagcacaacctgggctt
ggcttttttgaaacgctttcattagctttcaaacagcttacgactcagggcgtagttaaa
tttaatgttgtaattcctatctttttatttattttcctggcaccttttatcgggatggtt
atttcaattatcattacactgattatcgtacatctttataaaagaagtaatcctcataaa
gcggatcaggcgtttaaaaaactacagttagcttcttcagcactctttagtttaacacac
ggactgaatgatgctcaaaaagtaatgggtattatcggtgcagcagtaattttttaccat
gtaaacattttacaggacggatattctgcaatgccttcagctgacagattcaactacttt
gcgcagcattacctttgggtaccattagtatctttccttgctattgcattgggaacaatg
agtggcggttggaagattattaagaccatgggaactaagattacgaaagtaacaccactg
gaaggcgtaagtgctgaaacagcaggagcactaacattattcatcactgaatatttagct
attccggtttctacaacacacacgattacaggttctatcattggtgtaggacttacaaag
cgtgtttccgcagtacgctggggaattacagtaagtttactttgggcatggatacttacg
attccaattagtgctattgtagctgctattgcatatcttattgtaatattattctag

DBGET integrated database retrieval system