KEGG   Enterococcus faecalis V583: EF1613
Entry
EF1613            CDS       T00123                                 

Symbol
pflB
Name
(RefSeq) formate acetyltransferase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
efa  Enterococcus faecalis V583
Pathway
efa00620  Pyruvate metabolism
efa00640  Propanoate metabolism
efa00650  Butanoate metabolism
efa01100  Metabolic pathways
efa01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:efa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EF1613 (pflB)
   00640 Propanoate metabolism
    EF1613 (pflB)
   00650 Butanoate metabolism
    EF1613 (pflB)
Enzymes [BR:efa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     EF1613 (pflB)
SSDB
Motif
Pfam: PFL-like Gly_radical
Other DBs
NCBI-GeneID: 1200511
NCBI-ProteinID: NP_815326
UniProt: Q834N1
Position
complement(1568669..1570915)
AA seq 748 aa
MKQWEGFKGDKWRTSVDTRDFIQNNYTEYKGDDSFLEPIAPSTDKLWTKLQELFEIQHEK
NGVYDMDSDIPATITSHEPGYLIKEEEKIVGLQTDVPLKQAFMPFGGIKMANNALVSNGY
ETDEEMTKIFTEYRKTHNQGVFDAYTAEMRLARKNKIITGLPDAYGRGRIIGDYRRIALY
GIDYLMEQKKKDHDNTGNKEMTDDVIRLREEISEQYRALNDLKQMAASYGFDISRPAANA
QEAIQWLYFGYLGAIKSQNGAAMSIGRISAFLDIYIQRDLEAGLITEFEAQEMIDHLIMK
LRMVKFARTPEYNQLFSGYPIWATLSIAGMGIDGRSLVTKNDFRILHTLTNMGPSPEPNL
TVLYSSHLPEGFRTYAAKIAKESSSIQFENDDLLRENWGSDDCAIACCVSATVMGKDMQF
FGARANLAKAVLYAINGGVDEKTKMQVAPKYRPMTGDKLDYHEFMERYKDILDWLAELYV
NTLNIIHYMHDKYAYEAPQLALMDTDLQRTFATGIAGISHATDSIMAIKHGEVEVIRDED
GMAIDYVPTKEFPTYGNDNEEADAMANWILDYFMTQIKRQHTYRNSKPTTSLLTITSNVV
YGKATGNTPDGRRAGKPLAPGANPSYQDGKFLGEKNGLLASLNSTARLEYTIALDGISNT
QTINPNGLGKDDDTRINNLRNVLDGYFDKGGYHLNVNVFTNELLLDAQAHPEKYPNLTIR
VSGYAVKFRDLTPEQQADVISRTSHDRL
NT seq 2247 nt   +upstreamnt  +downstreamnt
atgaaacaatgggaaggctttaaaggcgacaaatggagaacaagcgttgacactcgtgat
tttattcaaaacaactacacagagtacaaaggcgacgacagtttcttagaaccaatcgct
ccgagcactgacaaattatggacaaaactacaagaattatttgaaatccaacatgaaaaa
aatggcgtttatgacatggatagcgatatcccagcaactattacgtcacatgaacctggt
tacttaatcaaagaagaagaaaaaattgtcggtttacaaacagatgtaccattaaaacaa
gcatttatgccattcggtggtattaaaatggcgaacaatgccttagtttcaaatggttat
gaaactgacgaagaaatgacaaaaatcttcacagaatacagaaaaacacataaccaaggt
gtttttgatgcctacacagctgaaatgcgtttagcacgtaaaaacaaaatcattactggt
cttccagatgcttatggccgtggccgtattatcggtgactatcgtcgtatcgcattatat
ggtatcgactacttaatggaacaaaagaaaaaagatcatgataacactggtaacaaagaa
atgacagacgatgttattcgcttacgtgaagaaatttctgaacaataccgtgcgttaaat
gacttaaaacaaatggctgcttcttatggtttcgatatttctcgtcctgctgcaaatgcg
caagaagcaatccaatggttatactttggttacctaggtgccattaaatctcaaaatggt
gcggcaatgtcaattggtcgtatctcagcattcttagatatctatatccaacgtgactta
gaagcaggtttaatcactgaatttgaagcacaagaaatgattgaccatttaatcatgaaa
ttacgtatggttaaatttgcacgtacaccagaatacaaccaattattctctggttatcca
atttgggcaacattatctattgctggtatgggtattgacggtcgttcattagttaccaaa
aatgacttccgtatcttacacaccttaacaaacatgggaccatctccagaacctaactta
actgtattgtattcttctcacttaccagaaggtttcagaacatatgcagctaaaatcgcg
aaagaaagctcatctatccaatttgaaaacgatgacttattacgtgaaaactggggctct
gacgactgtgcaatcgcatgttgtgtttctgcaacagttatgggtaaagatatgcaattc
ttcggcgctcgtgcgaacttagcgaaagctgttctttatgcaattaacggcggggtcgac
gaaaaaactaaaatgcaagtagcaccaaaatatcgtccaatgactggtgacaaattagat
taccatgaattcatggaacgctataaagacatcttagactggttagctgaattgtacgtt
aacacattaaacattattcattacatgcatgataaatatgcatatgaagcaccacaatta
gctttaatggatactgatttacaacggacattcgcaactggtattgccggaatctctcat
gcgactgatagtatcatggcaattaaacacggtgaagtagaagtaatccgtgacgaagat
ggtatggcaattgattatgtaccaacaaaagaattcccaacatacggaaacgataacgaa
gaagccgatgcaatggctaactggattttagattactttatgacacaaattaaacgtcaa
cacacataccgtaactctaaaccaacgacttcattattaacaatcacttcaaacgttgtt
tatggtaaagcaacagggaacacgcctgacggacgtcgtgctggcaaacctcttgcacca
ggtgcgaacccaagttatcaagacggtaaattcttaggtgagaaaaatggcttattagct
tcattaaactcaacagctcgtttagaatatacaatcgctttagatggtatttctaataca
caaaccatcaaccctaatggtttaggtaaagacgacgacacaagaattaacaacttacgt
aacgtattagatggctacttcgataaaggtggttaccacttaaacgtaaacgtatttaca
aacgaattattattagatgcacaagcacatccagaaaaatatccaaacttaactatccgt
gtatctggatatgccgtgaaattccgtgacttaactcctgaacaacaagcagacgttatt
tcaagaacttcacacgacagactataa

DBGET integrated database retrieval system