KEGG   Enterococcus faecalis V583: EF0237Help
Entry
EF0237            CDS       T00123                                 

Gene name
cbiO
Definition
(RefSeq) cobalt transporter ATP-binding protein
  KO
K16786  energy-coupling factor transport system ATP-binding protein [EC:3.6.3.-]
Organism
efa  Enterococcus faecalis V583
Pathway
efa02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:efa00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    EF0237 (cbiO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:efa02000]
    EF0237 (cbiO)
Enzymes [BR:efa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     EF0237 (cbiO)
Transporters [BR:efa02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Energy-coupling factor transporter
    Shared module
     EF0237 (cbiO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N AAA_21 AAA_29 AAA_22 AAA_15 SbcCD_C AAA_16 AAA AAA_5 IstB_IS21 AAA_23 RsgA_GTPase NB-ARC KdpD TniB Mg_chelatase AAA_24 AAA_33 AAA_30 NACHT ATP-synt_ab
Motif
Other DBs
NCBI-GeneID: 1199131
NCBI-ProteinID: NP_814034
UniProt: Q839D5
Position
215607..216446
Genome map
AA seq 279 aa AA seqDB search
MQPIIELNNIQFNYQPEDASPALKDVSFSIQQGEWVAIIGHNGSGKSTLAKTINGLLLPA
AGTIKVGGKELNEANVWDIRRMVGMVFQNPDNQFVGSTVEDDVAFGLENQGIPRDEMVER
VHDALERVRMLDFAKREPARLSGGQKQRVAIAGVVALRPDIIILDEATSMLDPEGRAEVI
ATIQKIKEESNLTVISITHDIDEAANANRILVMRQGQLTNEGTPEKIFSAGEALVEMGLD
LPFPEKLKVALKERGVVVPTNYLTEEGMVDWLWTSVLNK
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccaatcattgaactaaataatatccaatttaattatcaaccagaagatgcttct
cccgctttaaaagatgtgtctttttccattcaacaaggcgaatgggtcgctattattggc
cataatggttctggtaaatcaacgttagccaaaacgatcaatgggctgttactgccagct
gctgggactatcaaagttggcggcaaagaattaaatgaagcaaacgtctgggatatccgg
cgtatggtaggaatggtttttcagaatccagataaccaatttgtcggttcaacagtcgaa
gacgatgtggcttttggtttagaaaatcaaggtattccgcgtgatgaaatggtcgaacgt
gttcacgatgcattagaacgggttcgtatgttagattttgccaagcgagaacctgctcgg
ctatctggcggccaaaaacaacgagtagctatcgctggtgtggttgctttgcgaccagat
attattattttagacgaagcgacaagtatgttagatccagaaggtcgtgcagaagtaatt
gctaccattcaaaagattaaagaagaaagtaatttaacagttatttctattacccacgat
attgatgaagcggctaatgcgaatcgtattttagtgatgcgccaaggacaattgacaaac
gaaggaacaccagaaaagattttttctgcaggagaagcgcttgttgaaatgggcttggat
ttaccgtttcctgaaaaattaaaagtagctttgaaagagcgtggcgttgttgtgccaacg
aattatttaacagaagaagggatggtggattggttatggacatccgttttaaacaagtag

DBGET integrated database retrieval system