KEGG   Enterococcus faecalis V583: EF0237
Entry
EF0237            CDS       T00123                                 

Symbol
cbiO
Name
(RefSeq) cobalt transporter ATP-binding protein
  KO
K16786  energy-coupling factor transport system ATP-binding protein [EC:7.-.-.-]
Organism
efa  Enterococcus faecalis V583
Pathway
efa02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:efa00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    EF0237 (cbiO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:efa02000]
    EF0237 (cbiO)
Transporters [BR:efa02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Energy-coupling factor transporter
    EF0237 (cbiO)
SSDB
Motif
Pfam: ABC_tran SMC_N AAA_29 AAA_21 AAA_22 SbcCD_C AAA_15 AAA_16 AAA AAA_5 AAA_23 NB-ARC RsgA_GTPase KdpD TniB Mg_chelatase AAA_33 NACHT AAA_24 AAA_30 ATP-synt_ab AAA_13
Other DBs
NCBI-GeneID: 1199131
NCBI-ProteinID: NP_814034
UniProt: Q839D5
Position
215607..216446
AA seq 279 aa
MQPIIELNNIQFNYQPEDASPALKDVSFSIQQGEWVAIIGHNGSGKSTLAKTINGLLLPA
AGTIKVGGKELNEANVWDIRRMVGMVFQNPDNQFVGSTVEDDVAFGLENQGIPRDEMVER
VHDALERVRMLDFAKREPARLSGGQKQRVAIAGVVALRPDIIILDEATSMLDPEGRAEVI
ATIQKIKEESNLTVISITHDIDEAANANRILVMRQGQLTNEGTPEKIFSAGEALVEMGLD
LPFPEKLKVALKERGVVVPTNYLTEEGMVDWLWTSVLNK
NT seq 840 nt   +upstreamnt  +downstreamnt
atgcaaccaatcattgaactaaataatatccaatttaattatcaaccagaagatgcttct
cccgctttaaaagatgtgtctttttccattcaacaaggcgaatgggtcgctattattggc
cataatggttctggtaaatcaacgttagccaaaacgatcaatgggctgttactgccagct
gctgggactatcaaagttggcggcaaagaattaaatgaagcaaacgtctgggatatccgg
cgtatggtaggaatggtttttcagaatccagataaccaatttgtcggttcaacagtcgaa
gacgatgtggcttttggtttagaaaatcaaggtattccgcgtgatgaaatggtcgaacgt
gttcacgatgcattagaacgggttcgtatgttagattttgccaagcgagaacctgctcgg
ctatctggcggccaaaaacaacgagtagctatcgctggtgtggttgctttgcgaccagat
attattattttagacgaagcgacaagtatgttagatccagaaggtcgtgcagaagtaatt
gctaccattcaaaagattaaagaagaaagtaatttaacagttatttctattacccacgat
attgatgaagcggctaatgcgaatcgtattttagtgatgcgccaaggacaattgacaaac
gaaggaacaccagaaaagattttttctgcaggagaagcgcttgttgaaatgggcttggat
ttaccgtttcctgaaaaattaaaagtagctttgaaagagcgtggcgttgttgtgccaacg
aattatttaacagaagaagggatggtggattggttatggacatccgttttaaacaagtag

DBGET integrated database retrieval system