KEGG   Enterococcus faecalis V583: EF0900Help
Entry
EF0900            CDS       T00123                                 

Gene name
adhE
Definition
(RefSeq) bifunctional acetaldehyde-CoA/alcohol dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
efa  Enterococcus faecalis V583
Pathway
efa00010  Glycolysis / Gluconeogenesis
efa00350  Tyrosine metabolism
efa00620  Pyruvate metabolism
efa00625  Chloroalkane and chloroalkene degradation
efa00626  Naphthalene degradation
efa00650  Butanoate metabolism
efa01100  Metabolic pathways
efa01110  Biosynthesis of secondary metabolites
efa01120  Microbial metabolism in diverse environments
efa01130  Biosynthesis of antibiotics
efa01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:efa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EF0900 (adhE)
   00620 Pyruvate metabolism
    EF0900 (adhE)
   00650 Butanoate metabolism
    EF0900 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    EF0900 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    EF0900 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    EF0900 (adhE)
   00626 Naphthalene degradation
    EF0900 (adhE)
Enzymes [BR:efa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     EF0900 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     EF0900 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Motif
Other DBs
NCBI-GeneID: 1199789
NCBI-ProteinID: NP_814638
UniProt: Q837E3
Position
864152..866698
Genome map
AA seq 848 aa AA seqDB search
MIDELATKANVALKAMEDFTQEQVDHIVHQMAMAALDQHMPLAKMAVEETGRGIYEDKAI
KNMYASEYIWNNIKHDKTVGVINKDEQTGLMEIAEPVGVVCGVTPTTNPTSTTIFKSLIA
LKTRNPIVFAFHPSAQKCSAEAARIVRDAAIAAGAPENCIQWIEQPSIDATSALMNHPGI
AIVLATGGAGMVKSAYSTGKPALGVGPGNVPAYIEKTAKVKRAVNDLIVSKSFDNGMICA
SEQAVIVDKEIYASVKAEFEAHNVYFVKPNELQKLEDAVMNEGKYAVNPAIVGNSAEKIA
ELAGISVPKGTKILVAELEGAGPEYPLSREKLSPVLAMMKSNNAEHAFELCEAMLNLGGL
GHTAVIHTEDEELQVAFGLRMKACRILVNTPSAEGGIGNIYNEMIPSLTLGCGSYGKNSV
SKNVSAINLINIKTVAKRRNNMQWFKLPPKIFFEKNSLQYLQKMENVERVMLVCDPGMVQ
FGYADIVRKELQKRKNDVKIEVFSDVEPNPSTNTVYAGTKMMVDFQPDTVIALGGGSAMD
AAKGMWMFYEHPDTEFFGAKQKFLDIRKRTYKIAKPEKTQFVCIPTTSGTGSEVTPFAVI
TDSETHVKYPLADYALTPDVAIVDPQFVMSVPASVTADTGMDVLTHAIESYVSVMASDYT
RGLSLQAIKLVFDHLENSVKRPDMESREKMHNASTMAGMAFANAFLGICHSIAHKIGGEY
GIPHGRTNAILLPHIIRYNAKDPSKHAMFPKYDYFRADTDYADIAKFLGLKGNTTAELVE
ALATAVADLGKSVGIDMNLKAQGVSQETLDTTVDRMAELAYEDQCTTANPKEPLISELKQ
IILDAYVG
NT seq 2547 nt NT seq  +upstreamnt  +downstreamnt
atgattgatgaattagcaacaaaagcgaatgtcgctttaaaagcaatggaagattttaca
caagaacaagtagatcacattgtccatcaaatggcgatggcggcgttagaccaacatatg
cctttagcaaaaatggctgtcgaagaaactggccgtggaatctatgaagataaagcaatc
aaaaatatgtatgcatctgaatacatttggaataatattaaacatgataaaacagtgggt
gtaattaacaaagacgaacaaaccggcttaatggaaattgctgagccagttggcgtggta
tgtggggtcacaccaacaacgaacccaacgtcaacaactatttttaaatcactaattgcc
ttaaaaacaagaaatccaattgtttttgctttccatcctagcgcacaaaaatgttcggca
gaagcggcacgtattgtacgggatgcggcgattgcagcaggtgcaccagaaaattgtatt
caatggattgaacaaccatcgattgatgcaacatctgctttgatgaatcatccagggatt
gccattgttttagcaactggtggcgcaggcatggtaaaatctgcgtactcaacaggtaaa
ccagcactaggcgttggtcctgggaacgtaccagcttatattgaaaaaacagctaaagta
aaacgtgcggttaatgatttaattgtttcaaaatcatttgataatggaatgatttgtgct
tctgagcaagcggtcattgtggataaagaaatttatgcttctgtcaaagctgagtttgaa
gcacacaatgtttacttcgtgaaaccgaatgaattacaaaaactagaagatgcagtgatg
aatgaaggcaaatacgcagtaaatccagcgattgtcggtaactctgcagaaaaaattgct
gaattagcaggaattagtgtaccaaaaggcacaaaaattttagtcgctgaattagaaggt
gcaggtccagaatatccattatcaagagaaaaattatcgccagttttagcaatgatgaaa
tcaaacaatgcagagcatgcttttgaactatgtgaagcgatgttaaacttaggtggttta
ggacatacagcagtaattcatacagaagatgaagagttacaagttgcttttggtttacgt
atgaaagcttgtcgtattttagtgaatactccatcagcagaaggcggtatcggtaacatt
tataacgaaatgattccatccttaacacttggttgtggttcatacgggaaaaactctgtt
tctaaaaacgtatcagccattaacttaattaatattaaaacggtagcgaaacggagaaat
aatatgcaatggtttaaattacctccaaaaattttctttgaaaaaaattctttacaatat
ctacaaaaaatggaaaatgttgaacgtgtcatgttagtttgtgacccaggtatggttcaa
tttggctatgcagatatcgtacgtaaagagctacaaaaacgtaaaaatgatgtgaaaatc
gaagtattttctgatgttgaaccaaacccatcaacaaatactgtttatgcaggtaccaaa
atgatggttgatttccaaccagatacagtgattgccttgggtggcggttctgcaatggat
gcggcgaaaggaatgtggatgttctatgaacacccagatacagagttctttggtgcaaaa
caaaaattcttagatatccgcaaacggacatataaaattgccaaaccagaaaaaacacaa
tttgtttgtatcccaactacttcaggaactggttcagaagttacaccatttgccgttatt
actgatagtgaaacacacgtgaaatatccgttagcagactatgcgttaacaccagatgta
gcgattgttgatccacagttcgtaatgtctgtgccagcttcagtcactgcagatacaggt
atggatgttttaacacatgctattgaatcttatgtttccgtgatggcttcagattacaca
cgtggtttaagtttacaagcaatcaagttagttttcgatcatttagaaaattcagtgaaa
cgtccagatatggaatctcgcgaaaaaatgcataatgcatcaaccatggcagggatggca
tttgccaatgcattcttaggtatttgtcactctattgctcataaaattggtggggaatat
ggcattccacatggtcgtacaaatgcgattttattaccacatattattcgttacaatgcg
aaagatccatcaaaacacgcaatgttccctaaatatgattacttccgcgccgatactgat
tatgcagacattgcaaaattcttaggcttaaaaggaaatactaccgcagaactagtagaa
gctttagcaacagcagtagcagatttaggtaaatcagtcggaattgacatgaacttgaaa
gcccaaggtgtctcacaagaaacattagacacaacggttgatcgtatggcagaacttgca
tatgaagaccaatgtacaactgcaaatccgaaagaaccattaattagtgaactaaaacaa
attatcttagatgcttatgtaggataa

DBGET integrated database retrieval system