KEGG   Enterococcus faecalis V583: EF0979Help
Entry
EF0979            CDS       T00123                                 

Gene name
xseA
Definition
(RefSeq) exodeoxyribonuclease VII large subunit
  KO
K03601  exodeoxyribonuclease VII large subunit [EC:3.1.11.6]
Organism
efa  Enterococcus faecalis V583
Pathway
efa03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:efa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    EF0979 (xseA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:efa03400]
    EF0979 (xseA)
Enzymes [BR:efa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.6  exodeoxyribonuclease VII
     EF0979 (xseA)
DNA repair and recombination proteins [BR:efa03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA exonucleases
     EF0979 (xseA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exonuc_VII_L tRNA_anti_2 tRNA_anti-codon RecJ_OB
Motif
Other DBs
NCBI-GeneID: 1199867
NCBI-ProteinID: NP_814715
UniProt: Q836W6
Position
937576..938922
Genome map
AA seq 448 aa AA seqDB search
MTQQYLTVTALTKYLKRKFDADPYLGRVYLTGEISNFRFRANAHQYFSLKDDHAKISAIM
FKSAFQKLKFQPKEGMKVMVVGRISLYENSGSYQIYIEHMEPDGVGALYQALAELREKLG
KEGLFEGPKQQLPRYPKRIAVVTSPSGAVIRDIITTVKRRYPIAQLVLFPTLVQGEQAAD
DIVRNIQRADAQSDFDTMIIGRGGGSIEDLWPFNEEKVARAIHAATTPIISSVGHETDVT
IADMVADVRAATPTAAAELAVPVLNEELLRISERRSRLEQSFLYLLQQRTERFQRLQNSY
VFKQPERLYEGQTIKLDRMTQRLFQAMTTIHHQKQRQAQGIIAQLQQQTPKGQLRESQQQ
LAFLQRNLQTQMTQLFLNKQKQFTSAVQQLDLLSPLKIMGRGYSYTTKEDRVVKTVTELQ
PADQLTIHYADGTVQANVETITAKKEEF
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaacagtatttaacagtaacagccttaacgaagtatttaaaacgtaaatttgat
gcagacccttacttaggacgtgtctatttaacaggtgaaatttcgaactttcgcttccga
gcgaacgcgcatcagtacttcagtttaaaagatgatcatgcgaagatttctgcaattatg
tttaaatcagcctttcaaaaattgaagtttcaaccaaaagaaggcatgaaagtcatggtg
gtggggcgtatttcgctttatgaaaacagcggctcctatcaaatttatattgaacatatg
gaaccagatggtgtaggtgcactttatcaagcattggcagaattaagagaaaaactagga
aaagaaggactttttgaagggcctaaacaacagttgcctcgttatcccaaacgaatcgct
gtggttacaagtcctagtggtgctgttattcgggatatcattacgacagtcaaaagacgg
tatccgattgcacaactggtcctttttccaaccttggtccaaggcgagcaggcggcggat
gacattgtgcggaacattcagcgagccgatgcgcaaagcgattttgatacgatgatcatc
ggccgtggcggtggttcaatcgaggatttatggccatttaatgaagaaaaagtggctcga
gccattcatgctgccaccacaccgattatttcatcggttggtcacgaaacagatgtgaca
attgccgatatggtagcagatgttcgtgcagcaacgccaacggcagcagcggaactagcg
gtaccagttttaaatgaagaactattaagaattagtgaacggcgtagtcgtttagaacaa
agctttttatatctcttacaacaacgaacagaacgtttccaacgactacaaaattcttat
gtgtttaagcaacctgagcgactttatgaaggtcaaacgattaaattagatcgaatgacg
caacgtcttttccaagcaatgacaacaattcatcaccaaaaacaacgtcaagcccaagga
attatcgctcaattgcaacaacagacaccaaagggacaattaagagaaagtcagcaacaa
ttggcatttttacaacgaaacttgcaaacacaaatgacacaattgttcctaaacaaacaa
aagcaattcacgtctgctgttcaacaactagacttactcagcccactcaaaattatgggt
cgaggatatagttatactacaaaagaggaccgtgtcgttaaaactgttaccgagttacag
ccagcagatcaattaacgattcattatgctgacggtacagttcaagcaaacgtcgaaaca
ataacagcgaaaaaagaggagttttaa

DBGET integrated database retrieval system