KEGG   Enterococcus faecalis V583: EF1268
Entry
EF1268            CDS       T00123                                 

Definition
(RefSeq) cation transporter E1-E2 family ATPase
  KO
K12952  cation-transporting P-type ATPase E [EC:7.2.2.-]
Organism
efa  Enterococcus faecalis V583
Brite
KEGG Orthology (KO) [BR:efa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EF1268
Motif
Pfam: E1-E2_ATPase Hydrolase Hydrolase_3 BTRD1
Other DBs
NCBI-GeneID: 1200165
NCBI-ProteinID: NP_814991
UniProt: Q835V4
Position
1235095..1237515
AA seq 806 aa
MCLRRKKEMQENEPIAVTANAERYYPEDKQGLTAAQVEERQRKGLVNAAVDTEFITTKQI
VINNVFTYFNLIFVVLGVLLMLVQSYKNMTFLPVVIINTVIGIYQEIKSKKVLDSLNILN
ATKVTVVRDGQEQEISPDELVLDDVVLFKSGEQISGDAIVLSGEVRVNESLLTGESDEIT
KVADSQLLSGSFIVSGSCYARIDKIGAEAYVHQLTLEAKSIKKGEQSEMVGSINRLVKWV
GIIIIPIGCVLFFQSYFINHQGLHDSIVSMEAALIGMIPEGLYLLTTVALAASTMRLAKR
GVLLHNMKSIESLARVDVLCVDKTGTITENTMEVQELVPVVSIENDGTDLTNVEKLIGDF
CRTMSADNDTMKAMKEFFVTNNQREAVSYTSFSSVEKFSSVTFPEATYILGAPEMILRDN
YEMYQSEVEHYTSQGYRLLVFGKYLGEFQETLAAEVQPLGYILLWNPIRKEAKATFEYFA
EQNVAIKVISGDNPLTVSNVAQAAGIIGAENYVDARTLTTMEAQTEALEKYTVFGRVTPE
QKKQFVLLLKKLDHTVAMTGDGVNDILAMKEADCSIAMASGNQATAQASQVVLLDSDFST
MPEVVFEGRQVVNNIERSSSLFLVKNIFSLLMSVFAMIFAVTYPLQPTQVTLISLFTIGI
PSTFLALEPNHRRIEGKFLFNVLSKAIPGGLTDMLVVGALLICGDILALQKTDISTTATL
LLVSVGFMVLYKISSPMNRYRKRVMIGCLIGMVITSISMKNLFSLTSVSPTALLLLAILF
FAADSTFQHLSTISEKVQLWFYKKRH
NT seq 2421 nt   +upstreamnt  +downstreamnt
atgtgtttgagaagaaaaaaagaaatgcaagaaaatgaaccaatagcagtgactgctaac
gcagaacgctattatccagaagataaacaaggcttgacggccgcacaagttgaagaaaga
cagcgaaaaggcttagtcaatgccgccgtcgatacagagtttatcacaacgaaacagatt
gttattaataacgtatttacgtatttcaacttaatttttgtggtactaggtgtgttatta
atgctggtacaatcttataaaaatatgacctttttgccagtagtaatcattaatacggtc
attggaatttaccaagaaattaagtcgaagaaagtattagatagcttaaatattctaaat
gctacaaaagtaaccgttgtgagggatggccaagaacaagaaatttcgccagatgaactg
gttttggacgatgtggtgctctttaaatcgggtgaacagatttctggggatgcaattgtc
ttatctggtgaagtccgtgtgaatgaatccttgttaaccggggaatctgatgagattacc
aaagtagcagatagccaacttttgtcaggtagctttattgtgtcaggttcttgttatgca
agaattgataaaattggcgctgaggcctatgttcatcaattaacgcttgaagcgaaatca
attaaaaaaggggaacaatcagagatggtcggttccattaaccgtttggtgaaatgggta
gggattattattattccaatcggctgtgttctatttttccaaagttatttcatcaaccat
caagggcttcatgacagcattgtctccatggaagctgccttgattgggatgattccggaa
gggttgtaccttttaacaaccgttgcattagctgccagcacaatgcgcttagcgaagcgc
ggcgttttattgcacaacatgaaaagtatcgaatccttagcacgtgtcgatgtgttatgt
gtagataaaacaggaacaattactgaaaacacgatggaagtccaagagttggttcctgtg
gtgagtatcgaaaatgatggtacagacttaaccaatgtcgaaaaattaattggcgatttt
tgccgaacaatgtcagctgacaacgatacgatgaaagcgatgaaagaattttttgttact
aataatcagagggaagccgttagttatacctcgttttcgtctgtcgaaaaatttagtagc
gtgactttcccggaagcgacgtatattcttggggcgccagagatgattttgagagacaat
tatgaaatgtatcaatctgaagtggaacattatacaagtcaaggctatcgcttattggtg
ttcggaaagtatttaggagaatttcaggaaacgttggcagcagaggttcaacctctaggc
tacattcttctttggaatccgattcgtaaagaagccaaagcaacttttgaatatttcgct
gaacaaaatgtggctattaaggtcatttctggcgataatcctttaacagtatccaatgta
gcacaagcggcaggcattattggtgctgaaaattatgtggacgcgcgaacattaactaca
atggaagcccagacagaagctttagaaaaatacaccgtttttggtcgtgtcacgccagaa
caaaagaaacaatttgtattattgttgaaaaaattagatcatacagtggcgatgacaggg
gatggagtcaatgatattttagccatgaaagaagcagattgtagtattgccatggcttca
ggaaatcaagctacagcacaagcctcgcaagttgtgttgttggattctgatttttcaacg
atgccggaggttgtctttgaaggccgccaagtagttaataacattgaacgctcttcaagt
ttattccttgtaaaaaatattttctccttgctgatgtctgtctttgctatgatttttgcc
gtgacatatcctttacaaccgacacaagtcacattgattagtttatttacaattgggatt
ccttcgacatttctagctttggaaccaaatcatcgtcgcattgaagggaaatttcttttc
aatgtgttatcaaaagcaattcctggtgggttaacggatatgttagtagtcggtgcctta
ctaatttgtggtgatattcttgcacttcaaaaaacggacatttcaacgactgcaacattg
ttgctagtttcagtcggctttatggttctttataaaattagttcaccaatgaatcgttac
cgcaagcgcgtaatgattggctgtttaatcggaatggttattacaagtatttccatgaaa
aacttgttctcgttaacttcggtatcgccaacagccttgttacttttagccattcttttc
tttgcagcagactcaactttccaacatttatcaaccatttctgaaaaagttcaattatgg
ttttataagaaaagacattag

DBGET integrated database retrieval system