KEGG   Enterococcus faecalis V583: EF1382Help
Entry
EF1382            CDS       T00123                                 

Gene name
pepT-1
Definition
(RefSeq) peptidase T
  KO
K01258  tripeptide aminopeptidase [EC:3.4.11.4]
Organism
efa  Enterococcus faecalis V583
Brite
KEGG Orthology (KO) [BR:efa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:efa01002]
    EF1382 (pepT-1)
Enzymes [BR:efa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.4  tripeptide aminopeptidase
     EF1382 (pepT-1)
Peptidases [BR:efa01002]
 Metallo Peptidases
  Family M20
   EF1382 (pepT-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M42
Motif
Other DBs
NCBI-GeneID: 1200282
NCBI-ProteinID: NP_815103
UniProt: Q835J5
Position
1360686..1361915
Genome map
AA seq 409 aa AA seqDB search
MYENLLPRFLRYVKTETRSDATSTTTPSTQTQVAFAQTLKKELEELGMSDVIYNETNGFV
IATLPSNVEKDVRSIGFIAHMDTADFNAVNVSPQIVENYDGESTIPLDKEGKFTLNTKDF
PNLKNYRGETLITTDGTTLLGADDKSGIAEIMTAMEYLINHPEIKHGTIRVAFGPDEEIG
VGADKFDVAQFNVDFAYTMDGGPVGELQFETFNAAQAEITIQGKNVHPGTAKNTMINALQ
LGIDFHNALPADEVPEKTAGEEGFYHLAAFAGTPEEATMTYIIRDHNREIFEARKAKIKE
IQQTLNAPFDEERIKVDLFDQYYNMREVIEKDMSIVEIAKQAMEELSIQPIIEPVRGGTD
GSKISYLGIPTPNIFAGGENMHGRFEFVSLQAMEKATNVIIKIAELNAK
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgtatgaaaatctattacctcgttttttacggtatgtgaaaacagaaacacgctcggat
gcaactagcacaacgacaccatcaacacaaacacaagtagcctttgcacaaaccttaaaa
aaagaattagaagaattagggatgagcgatgttatttataacgaaacaaatggttttgtg
attgctacgttacctagtaacgtggagaaagacgttcgttcaatcggctttattgcccat
atggataccgctgattttaatgcagtgaatgtttctccgcaaattgttgagaactatgac
ggagaatcaacgattcctttagataaagaaggcaaattcactttaaacacgaaagacttt
cctaacttaaaaaattatcgtggtgaaacacttattacaaccgatggtaccactttatta
ggagctgatgataaatcaggtattgcggaaataatgacagccatggaatatttaattaat
cacccagaaattaaacatggcaccattcgtgtggctttcggtcctgacgaagaaattggt
gtaggtgccgacaaatttgatgtcgctcaatttaacgtggattttgcttatacaatggat
ggtgggccagtaggcgaattacaatttgaaacgtttaatgcggcgcaagcagaaattaca
attcaagggaaaaacgttcatccaggaacagccaaaaatacaatgattaatgcgttacaa
ttaggaattgatttccataatgccttacctgctgacgaagttccagaaaaaacagcaggt
gaagaaggcttttatcatttagcagcgtttgctggaacgccagaagaagctacaatgacg
tatattattcgcgatcacaatcgcgagatttttgaagcacgtaaagctaaaattaaagaa
attcagcaaacattgaatgcaccatttgatgaagaacgaatcaaagttgatttatttgat
caatactataatatgcgagaagtgattgaaaaagatatgtccattgtcgaaattgctaaa
caagcaatggaagaattgtcaattcaaccaattattgaacctgttcgcggtggaacggat
ggctcaaaaatttcttatttagggattcccacaccaaatatctttgctggtggcgaaaat
atgcatggccgttttgaatttgtttcattacaagccatggaaaaagcgaccaatgtgatt
attaaaattgctgaattaaatgcaaaataa

DBGET integrated database retrieval system