KEGG   Enterococcus faecalis V583: EF1878Help
Entry
EF1878            CDS       T00123                                 

Definition
(RefSeq) ATP/GTP-binding protein
Organism
efa  Enterococcus faecalis V583
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_10 DUF853 DUF3461
Motif
Other DBs
NCBI-GeneID: 1200758
NCBI-ProteinID: NP_815561
UniProt: Q833R2
Position
complement(1823909..1826356)
Genome map
AA seq 815 aa AA seqDB search
MYPIKYVENNLVFNQEGECFAYYELVPYNYSFLSPEQKYQVHDNFRQLIAQNREGKIHAL
QIATESSIRATQERSKKEITGRLKEVAKQRIDLQTDALVSMIGDSQIDYRFFIGFKLIAT
DEEVNLKSLKKSFLSGLQEFVYGVNHHLMGDFVSLSNEEIRRYTKLEKLMESKLARRFKV
RRVTPSDLTYLIEHIYGEKGTPFEEYEFQLPKKKLKSETLVKRYDLLHPSRCLIEENPRY
LRMEHENHESYVAYLTINTIVGEMEFPSSELFYYQQQQFTFPIDTSMNVEIVTNKKALAT
VRNKKKELKDLDNHAYQSDNETNSNVLDALDSVNELETTLDQSKESMYKLSYVVRVSAES
VDELKRRCDEVFDFYDDTNVKLVRPFGDMMGLHEEFLPSSKRYMNDYIQYVTSDFLAGLG
FGATQKLGELEGIYFGYNVDTGRNVYLKPALASQGVKGSVTNALAAAFLGSLGGGKSFSN
NLLVYYAVLFGGQAVIVDPKGERGGWKENLPEIADEINILNLTSKPENQGLLDPYVIMKK
KKDSESLAIDILTFLTGISSRDGEKFPVLRKAIRTVTQSDQRGLLQVINELRKENSPVAE
NIADHIESFTDYDFAHLLFSDGSITQSISLDKQLNIIQVADLVLPDAETTFEEYTTMELL
SVSMLIVISTFALDFIHSNREIFKIVDLDEAWSFLQVAQGKTLSNKLVRAGRAMNAGVYF
VTQNSDDLLDERLKNNIGLKFAFRSTDIHEIKKTLEFFGLDQEDESNQKRLRDLENGQCL
MQDLYGRVGVVQVHPVFEELFHAFDTRPPVQERME
NT seq 2448 nt NT seq  +upstreamnt  +downstreamnt
atgtacccgattaagtatgttgaaaataatcttgtctttaatcaagagggagaatgtttt
gcctactatgaacttgtgccttataactattccttcttatcgcctgaacagaagtatcaa
gtgcacgataactttcgtcaattgattgctcagaatcgtgaaggcaagatccatgcctta
caaattgccacagaaagtagtattcgtgccacgcaagaacgatcaaaaaaggaaattaca
ggcagactcaaagaagtcgcgaaacaacgaattgaccttcaaacagatgcattagtatct
atgattggcgatagtcagattgattatcgcttttttattggctttaaactaattgcaaca
gatgaagaggtcaatttaaagagtctcaagaaatctttcctttctgggcttcaagaattt
gtctatggggtgaaccatcatttgatgggtgattttgtttccttatccaatgaagaaatt
cgccgatataccaagcttgaaaaactaatggaaagtaaattggctagaagattcaaagtc
agacgggtcacaccgagtgatctgacgtatttaattgaacatatttatggcgaaaaaggc
acaccgtttgaagaatatgaatttcagctaccaaagaaaaagctaaaatcagaaacgctg
gtgaaacgttatgatttattacatcctagtcgttgcttgattgaagaaaatcctcggtac
ttacgcatggaacatgaaaatcatgaatcgtatgtagcctatttgacaatcaatacgatt
gtaggggagatggagtttccttcttcagaacttttttattaccagcaacaacaattcact
tttcccattgatacttcaatgaatgtggagattgtgaccaataaaaaagctcttgccact
gttcgcaataagaaaaaagaactgaaagatttagacaaccatgcctaccaatccgataat
gagacaaattccaatgtcttagatgctttggattcagtaaatgagttggaaactaccttg
gatcaatccaaggagtcgatgtacaaattaagttatgtagttcgagtgagtgcggaatcc
gtggatgaattaaaacgccgttgtgatgaagtgttcgatttttatgatgatactaatgta
aaactagtccgaccctttggcgatatgatggggctacatgaagaattcttgccctcaagc
aaacgctatatgaacgattatatccaatatgttacttctgactttttagcgggacttggt
tttggggctactcaaaagctaggggaattagaaggcatctactttggctacaatgtagat
acggggcggaatgtttacctgaaaccggcattagcttcacaaggggtcaagggttcagtt
accaatgctttggctgctgcgttccttggttcactcggtggcggaaaatcctttagtaac
aatctcttggtctactatgctgttctttttggtggccaagctgtgattgtcgatccaaaa
ggagaacgaggtggttggaaagaaaacttgccagaaattgcggatgaaatcaatattctc
aacttgactagtaaaccagaaaatcaaggcttacttgatccttatgtgattatgaagaaa
aagaaagattcagaaagtttagcaattgatatcctgacttttttaacaggaatttccagt
cgggatggggagaagtttccagtattgcgcaaagccattcggacggttacccaaagtgat
caacgaggattgctgcaagtcattaatgagcttcgaaaggagaactctccagtcgcggaa
aatatcgccgatcatatcgagtcctttaccgattatgattttgcccatttgcttttctca
gatggttcgattacccaatcaattagtttagataagcagttgaatatcattcaagtagcg
gatttggttttaccagatgcagaaaccacttttgaagaatataccacgatggagttgcta
agtgtctctatgctaatcgtcatttccacgtttgccttggattttatccatagtaatcga
gaaatcttcaagattgtggacctggatgaggcttggagttttcttcaagtggctcaagga
aagaccctttcaaataagctcgttcgtgctggtcgggccatgaatgccggtgtttacttt
gtcacgcaaaatagtgacgatttactggatgaacgcttgaagaataatatcggattgaaa
tttgcttttcgtagtaccgatattcatgaaatcaagaagactttggaattttttgggttg
gatcaagaagatgaaagtaatcaaaaacgcctacgagatttggaaaacggccaatgcttg
atgcaggatttgtatggtcgggtaggcgtggttcaggtacatccagtctttgaagaactc
ttccatgcctttgatacccgtccacctgttcaagagagaatggagtga

DBGET integrated database retrieval system